KEGG   Alpha proteobacterium HIMB5: HIMB5_00014040Help
Entry
HIMB5_00014040    CDS       T02250                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HIMB5_00014040
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB5_00014040
   00620 Pyruvate metabolism
    HIMB5_00014040
   00640 Propanoate metabolism
    HIMB5_00014040
  Energy metabolism
   00680 Methane metabolism
    HIMB5_00014040
Enzymes [BR:apm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HIMB5_00014040
Lipid biosynthesis proteins [BR:apm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HIMB5_00014040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285347..1287452)
Genome map
AA seq 701 aa AA seqDB search
MTKKKKRKTKKKTSKKVKKKKFKKVKKSKTRKKISNKTKSSKKKTKKRIKKNLENKEQEL
VLKTRSEWVKNSLASKAQYTKKYNDSIKNNNEFWAKEGKRITWIKPYSKIKDVKYSNTDV
RIKWFEDGTLNASANCIDRHLENKKDETAIIWVGDDPKDTQKISYKQLHQKVSKAANGLK
KLGIKKGDRVTIYLTMIPELAVLMLACTRIGAIHSIIFGGFSADSISGRVNDCESEYIIT
ADEGVRGGKTIPLKEITDEALRSCPNVKKCIVVKRTGNSVSWDYDRDVWYDELIKDVSNH
CEPEEMNAEDPMFILYTSGSTGKPKGVLHTTGGYMVYASMTHEYIFNYKPKDIYWCTADI
GWVTGHSYIIYGPLANGATTIMFEGIPTYPDSSRWWQIIDKYKVNIFYTAPTAIRALMRE
GDGPVKKTSRKSLKLLGTVGEPINPEAWMWYYKTVGNSKCPIVDTWWQTETGGIMIAPQT
GAINLKPGSATKPFYGIKPSLVDKDGNEIKGAGEGRLCISQSWPGQMRTVYGDHQRFIDT
YFSQFDGKYFTGDGCRRDKDGYYWITGRVDDVIIVSGHNLGTAEIESAFVAHPKVAEAAV
VGYPHDIKGNGLYCYVTLNAGEQENGELERDLKLWVRKQIGPLATPDIIHFSPGLPKTRS
GKIMRRILRKIAANEHDQLGDTTTLADPSVVDSLVENRKNI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagaaaaaaagaaaaactaaaaaaaaaacatctaaaaaagtcaaaaaaaaa
aaatttaaaaaagtaaaaaaaagtaaaactagaaaaaaaatttctaataaaactaagtca
tcaaagaaaaaaaccaaaaaaagaattaaaaaaaatttagaaaataaagaacaggaactt
gttttgaagacaagatctgaatgggtaaaaaacagcttagcaagtaaagcacagtataca
aagaaatataatgactctataaaaaataataatgaattttgggcgaaggaaggaaaaaga
attacctggatcaaaccttattctaaaattaaagatgtaaaatacagtaatactgatgtt
agaattaaatggttcgaagatggaacgcttaatgcttcggcaaattgcatagatagacat
ttagaaaataaaaaagatgaaactgcaattatttgggtgggtgacgatccaaaagataca
caaaaaatttcatataaacaactacatcaaaaagtttcaaaagcagctaatggtcttaag
aaattaggaattaaaaaaggtgacagagtaacaatttatttaactatgatacctgaactt
gctgttcttatgttggcttgtacaagaattggagcaattcattctataatttttggtgga
ttttcagcagactctatttctggaagagttaatgattgtgagtctgaatatataatcaca
gctgatgaaggagtaagaggtggaaaaactattcctttaaaagaaattacagatgaagct
ttaagaagttgtccaaacgtaaaaaaatgtattgtagttaaaagaacaggtaattctgta
agctgggattacgacagagacgtttggtatgatgaattaattaaagatgtatctaatcat
tgtgaacctgaagaaatgaacgcagaagatccgatgttcatactttatacatctggttca
acaggcaaacctaaaggggttcttcatacaacaggtggttatatggtgtatgcttcgatg
acacacgaatatattttcaattataaaccaaaagatatttattggtgtacagctgatatt
ggttgggtgacaggtcatagttatatcatttatggtcctctagctaacggagcaacaaca
ataatgttcgaaggaataccaacttatccggatagctcaaggtggtggcaaataattgat
aaatacaaagtgaatattttttacacagctccaacagctataagagcgctaatgagagaa
ggtgatggacctgttaaaaaaacttctagaaaatctttaaaacttttgggaactgtaggt
gagccaattaatccagaagcatggatgtggtattataaaacagttggaaattcaaaatgc
ccaattgttgatacttggtggcaaacagaaactggtggaataatgattgcaccccaaact
ggtgctatcaacctaaaaccaggttcagcaacaaaaccattctatggaattaagccatca
ttagttgataaagatggaaatgaaatcaaaggagctggtgaaggtagattgtgtatttct
caatcttggccaggccaaatgagaactgtttatggtgatcatcaaagatttatagatact
tatttctctcaatttgatggaaaatatttcactggagacgggtgtagaagagacaaagat
ggctactactggataacaggaagagttgatgatgttatcatcgtttcaggacataattta
ggaactgccgaaattgaaagtgcatttgtagctcatccaaaagtagctgaggctgctgta
gtgggctatccacacgacattaaaggtaatggtttgtattgttatgttactttaaatgcc
ggtgagcaagaaaatggagaacttgaaagagacttaaaactttgggttagaaaacaaatt
ggtcctttagcaactcctgacataattcatttttcacctggcttaccaaaaacaagatct
ggaaaaatcatgagaagaattttaagaaagatagctgctaatgaacatgatcagctaggt
gatactactacattagctgatccatctgttgtagatagtttggtagaaaatagaaaaaat
atttaa

DBGET integrated database retrieval system