KEGG   Alpha proteobacterium HIMB5: HIMB5_00014040Help
Entry
HIMB5_00014040    CDS       T02250                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apm00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:apm00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:apm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1285347..1287452)
Genome map
AA seq 701 aa AA seqDB search
MTKKKKRKTKKKTSKKVKKKKFKKVKKSKTRKKISNKTKSSKKKTKKRIKKNLENKEQEL
VLKTRSEWVKNSLASKAQYTKKYNDSIKNNNEFWAKEGKRITWIKPYSKIKDVKYSNTDV
RIKWFEDGTLNASANCIDRHLENKKDETAIIWVGDDPKDTQKISYKQLHQKVSKAANGLK
KLGIKKGDRVTIYLTMIPELAVLMLACTRIGAIHSIIFGGFSADSISGRVNDCESEYIIT
ADEGVRGGKTIPLKEITDEALRSCPNVKKCIVVKRTGNSVSWDYDRDVWYDELIKDVSNH
CEPEEMNAEDPMFILYTSGSTGKPKGVLHTTGGYMVYASMTHEYIFNYKPKDIYWCTADI
GWVTGHSYIIYGPLANGATTIMFEGIPTYPDSSRWWQIIDKYKVNIFYTAPTAIRALMRE
GDGPVKKTSRKSLKLLGTVGEPINPEAWMWYYKTVGNSKCPIVDTWWQTETGGIMIAPQT
GAINLKPGSATKPFYGIKPSLVDKDGNEIKGAGEGRLCISQSWPGQMRTVYGDHQRFIDT
YFSQFDGKYFTGDGCRRDKDGYYWITGRVDDVIIVSGHNLGTAEIESAFVAHPKVAEAAV
VGYPHDIKGNGLYCYVTLNAGEQENGELERDLKLWVRKQIGPLATPDIIHFSPGLPKTRS
GKIMRRILRKIAANEHDQLGDTTTLADPSVVDSLVENRKNI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagaaaaaaagaaaaactaaaaaaaaaacatctaaaaaagtcaaaaaaaaa
aaatttaaaaaagtaaaaaaaagtaaaactagaaaaaaaatttctaataaaactaagtca
tcaaagaaaaaaaccaaaaaaagaattaaaaaaaatttagaaaataaagaacaggaactt
gttttgaagacaagatctgaatgggtaaaaaacagcttagcaagtaaagcacagtataca
aagaaatataatgactctataaaaaataataatgaattttgggcgaaggaaggaaaaaga
attacctggatcaaaccttattctaaaattaaagatgtaaaatacagtaatactgatgtt
agaattaaatggttcgaagatggaacgcttaatgcttcggcaaattgcatagatagacat
ttagaaaataaaaaagatgaaactgcaattatttgggtgggtgacgatccaaaagataca
caaaaaatttcatataaacaactacatcaaaaagtttcaaaagcagctaatggtcttaag
aaattaggaattaaaaaaggtgacagagtaacaatttatttaactatgatacctgaactt
gctgttcttatgttggcttgtacaagaattggagcaattcattctataatttttggtgga
ttttcagcagactctatttctggaagagttaatgattgtgagtctgaatatataatcaca
gctgatgaaggagtaagaggtggaaaaactattcctttaaaagaaattacagatgaagct
ttaagaagttgtccaaacgtaaaaaaatgtattgtagttaaaagaacaggtaattctgta
agctgggattacgacagagacgtttggtatgatgaattaattaaagatgtatctaatcat
tgtgaacctgaagaaatgaacgcagaagatccgatgttcatactttatacatctggttca
acaggcaaacctaaaggggttcttcatacaacaggtggttatatggtgtatgcttcgatg
acacacgaatatattttcaattataaaccaaaagatatttattggtgtacagctgatatt
ggttgggtgacaggtcatagttatatcatttatggtcctctagctaacggagcaacaaca
ataatgttcgaaggaataccaacttatccggatagctcaaggtggtggcaaataattgat
aaatacaaagtgaatattttttacacagctccaacagctataagagcgctaatgagagaa
ggtgatggacctgttaaaaaaacttctagaaaatctttaaaacttttgggaactgtaggt
gagccaattaatccagaagcatggatgtggtattataaaacagttggaaattcaaaatgc
ccaattgttgatacttggtggcaaacagaaactggtggaataatgattgcaccccaaact
ggtgctatcaacctaaaaccaggttcagcaacaaaaccattctatggaattaagccatca
ttagttgataaagatggaaatgaaatcaaaggagctggtgaaggtagattgtgtatttct
caatcttggccaggccaaatgagaactgtttatggtgatcatcaaagatttatagatact
tatttctctcaatttgatggaaaatatttcactggagacgggtgtagaagagacaaagat
ggctactactggataacaggaagagttgatgatgttatcatcgtttcaggacataattta
ggaactgccgaaattgaaagtgcatttgtagctcatccaaaagtagctgaggctgctgta
gtgggctatccacacgacattaaaggtaatggtttgtattgttatgttactttaaatgcc
ggtgagcaagaaaatggagaacttgaaagagacttaaaactttgggttagaaaacaaatt
ggtcctttagcaactcctgacataattcatttttcacctggcttaccaaaaacaagatct
ggaaaaatcatgagaagaattttaagaaagatagctgctaatgaacatgatcagctaggt
gatactactacattagctgatccatctgttgtagatagtttggtagaaaatagaaaaaat
atttaa

DBGET integrated database retrieval system