KEGG   Alpha proteobacterium HIMB5: HIMB5_00014040Help
Entry
HIMB5_00014040    CDS       T02250                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00010  Glycolysis / Gluconeogenesis
apm00620  Pyruvate metabolism
apm00640  Propanoate metabolism
apm00680  Methane metabolism
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
apm01130  Biosynthesis of antibiotics
apm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HIMB5_00014040
   00620 Pyruvate metabolism
    HIMB5_00014040
   00640 Propanoate metabolism
    HIMB5_00014040
  Energy metabolism
   00680 Methane metabolism
    HIMB5_00014040
Enzymes [BR:apm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HIMB5_00014040
Lipid biosynthesis proteins [BR:apm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HIMB5_00014040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFS48141
UniProt: J9YZ16
Position
complement(1285347..1287452)
Genome map
AA seq 701 aa AA seqDB search
MTKKKKRKTKKKTSKKVKKKKFKKVKKSKTRKKISNKTKSSKKKTKKRIKKNLENKEQEL
VLKTRSEWVKNSLASKAQYTKKYNDSIKNNNEFWAKEGKRITWIKPYSKIKDVKYSNTDV
RIKWFEDGTLNASANCIDRHLENKKDETAIIWVGDDPKDTQKISYKQLHQKVSKAANGLK
KLGIKKGDRVTIYLTMIPELAVLMLACTRIGAIHSIIFGGFSADSISGRVNDCESEYIIT
ADEGVRGGKTIPLKEITDEALRSCPNVKKCIVVKRTGNSVSWDYDRDVWYDELIKDVSNH
CEPEEMNAEDPMFILYTSGSTGKPKGVLHTTGGYMVYASMTHEYIFNYKPKDIYWCTADI
GWVTGHSYIIYGPLANGATTIMFEGIPTYPDSSRWWQIIDKYKVNIFYTAPTAIRALMRE
GDGPVKKTSRKSLKLLGTVGEPINPEAWMWYYKTVGNSKCPIVDTWWQTETGGIMIAPQT
GAINLKPGSATKPFYGIKPSLVDKDGNEIKGAGEGRLCISQSWPGQMRTVYGDHQRFIDT
YFSQFDGKYFTGDGCRRDKDGYYWITGRVDDVIIVSGHNLGTAEIESAFVAHPKVAEAAV
VGYPHDIKGNGLYCYVTLNAGEQENGELERDLKLWVRKQIGPLATPDIIHFSPGLPKTRS
GKIMRRILRKIAANEHDQLGDTTTLADPSVVDSLVENRKNI
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaagaaaaaaagaaaaactaaaaaaaaaacatctaaaaaagtcaaaaaaaaa
aaatttaaaaaagtaaaaaaaagtaaaactagaaaaaaaatttctaataaaactaagtca
tcaaagaaaaaaaccaaaaaaagaattaaaaaaaatttagaaaataaagaacaggaactt
gttttgaagacaagatctgaatgggtaaaaaacagcttagcaagtaaagcacagtataca
aagaaatataatgactctataaaaaataataatgaattttgggcgaaggaaggaaaaaga
attacctggatcaaaccttattctaaaattaaagatgtaaaatacagtaatactgatgtt
agaattaaatggttcgaagatggaacgcttaatgcttcggcaaattgcatagatagacat
ttagaaaataaaaaagatgaaactgcaattatttgggtgggtgacgatccaaaagataca
caaaaaatttcatataaacaactacatcaaaaagtttcaaaagcagctaatggtcttaag
aaattaggaattaaaaaaggtgacagagtaacaatttatttaactatgatacctgaactt
gctgttcttatgttggcttgtacaagaattggagcaattcattctataatttttggtgga
ttttcagcagactctatttctggaagagttaatgattgtgagtctgaatatataatcaca
gctgatgaaggagtaagaggtggaaaaactattcctttaaaagaaattacagatgaagct
ttaagaagttgtccaaacgtaaaaaaatgtattgtagttaaaagaacaggtaattctgta
agctgggattacgacagagacgtttggtatgatgaattaattaaagatgtatctaatcat
tgtgaacctgaagaaatgaacgcagaagatccgatgttcatactttatacatctggttca
acaggcaaacctaaaggggttcttcatacaacaggtggttatatggtgtatgcttcgatg
acacacgaatatattttcaattataaaccaaaagatatttattggtgtacagctgatatt
ggttgggtgacaggtcatagttatatcatttatggtcctctagctaacggagcaacaaca
ataatgttcgaaggaataccaacttatccggatagctcaaggtggtggcaaataattgat
aaatacaaagtgaatattttttacacagctccaacagctataagagcgctaatgagagaa
ggtgatggacctgttaaaaaaacttctagaaaatctttaaaacttttgggaactgtaggt
gagccaattaatccagaagcatggatgtggtattataaaacagttggaaattcaaaatgc
ccaattgttgatacttggtggcaaacagaaactggtggaataatgattgcaccccaaact
ggtgctatcaacctaaaaccaggttcagcaacaaaaccattctatggaattaagccatca
ttagttgataaagatggaaatgaaatcaaaggagctggtgaaggtagattgtgtatttct
caatcttggccaggccaaatgagaactgtttatggtgatcatcaaagatttatagatact
tatttctctcaatttgatggaaaatatttcactggagacgggtgtagaagagacaaagat
ggctactactggataacaggaagagttgatgatgttatcatcgtttcaggacataattta
ggaactgccgaaattgaaagtgcatttgtagctcatccaaaagtagctgaggctgctgta
gtgggctatccacacgacattaaaggtaatggtttgtattgttatgttactttaaatgcc
ggtgagcaagaaaatggagaacttgaaagagacttaaaactttgggttagaaaacaaatt
ggtcctttagcaactcctgacataattcatttttcacctggcttaccaaaaacaagatct
ggaaaaatcatgagaagaattttaagaaagatagctgctaatgaacatgatcagctaggt
gatactactacattagctgatccatctgttgtagatagtttggtagaaaatagaaaaaat
atttaa

DBGET integrated database retrieval system