KEGG   Alpha proteobacterium HIMB5: HIMB5_00014090Help
Entry
HIMB5_00014090    CDS       T02250                                 

Definition
Uroporphyrinogen-III synthase HemD
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:apm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1291934..1292632
Genome map
AA seq 232 aa AA seqDB search
MHILLTRPIDDSIEMIEKFKSLGHDVSHLPLLNIEKVNHENFNFNNYDAFIFSSSNSIKF
LDIKNINKNIKCFSVGSATEKKIRALGFQNVIPAEGSVNSLIEIIQNNFDTSDGKLLYIS
GETIAYELDKDLKNKGYNIDRLINYKTSHNYFNDINFIKELKKKIPNIVYIYSENSAKSF
LKFINNSGLKDDWMDTNLMCMGEKASTILNEIKWKKIFLFNPGEEEFLLYKI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcatattttattaacaagaccaatagatgacagtattgaaatgatagaaaaatttaaa
tcactaggtcatgatgtgtctcatctaccattattaaatatagaaaaagtaaatcatgaa
aatttcaattttaataattacgatgcatttattttttcaagctccaattcaattaaattt
ctggacataaaaaatataaataaaaatatcaaatgtttttcagtagggtctgcaactgaa
aaaaaaattcgcgcgctaggatttcaaaatgtaatacctgctgaaggcagtgttaatagc
ttgatagaaattattcaaaataattttgatacttcagacggtaaattattatatatcagt
ggtgaaactattgcttatgaattagacaaagatttaaaaaacaaaggatacaatattgat
agattaattaattacaaaacaagtcataattattttaacgatattaattttattaaagag
ttaaaaaaaaaaataccaaatattgtttatatttattctgaaaatagtgcgaaaagtttt
ttgaaattcattaataattcaggcttgaaagatgattggatggatacaaacttaatgtgt
atgggcgaaaaagcatctacaatacttaatgagataaaatggaaaaaaatttttcttttt
aatcctggagaagaagagtttttgttatataaaatttaa

DBGET integrated database retrieval system