KEGG   Alpha proteobacterium HIMB5: HIMB5_00014090Help
Entry
HIMB5_00014090    CDS       T02250                                 

Definition
(GenBank) Uroporphyrinogen-III synthase HemD
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
apm00860  Porphyrin and chlorophyll metabolism
apm01100  Metabolic pathways
apm01110  Biosynthesis of secondary metabolites
apm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HIMB5_00014090
Enzymes [BR:apm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HIMB5_00014090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AFS48146
UniProt: J9YZ35
Position
1291934..1292632
Genome map
AA seq 232 aa AA seqDB search
MHILLTRPIDDSIEMIEKFKSLGHDVSHLPLLNIEKVNHENFNFNNYDAFIFSSSNSIKF
LDIKNINKNIKCFSVGSATEKKIRALGFQNVIPAEGSVNSLIEIIQNNFDTSDGKLLYIS
GETIAYELDKDLKNKGYNIDRLINYKTSHNYFNDINFIKELKKKIPNIVYIYSENSAKSF
LKFINNSGLKDDWMDTNLMCMGEKASTILNEIKWKKIFLFNPGEEEFLLYKI
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcatattttattaacaagaccaatagatgacagtattgaaatgatagaaaaatttaaa
tcactaggtcatgatgtgtctcatctaccattattaaatatagaaaaagtaaatcatgaa
aatttcaattttaataattacgatgcatttattttttcaagctccaattcaattaaattt
ctggacataaaaaatataaataaaaatatcaaatgtttttcagtagggtctgcaactgaa
aaaaaaattcgcgcgctaggatttcaaaatgtaatacctgctgaaggcagtgttaatagc
ttgatagaaattattcaaaataattttgatacttcagacggtaaattattatatatcagt
ggtgaaactattgcttatgaattagacaaagatttaaaaaacaaaggatacaatattgat
agattaattaattacaaaacaagtcataattattttaacgatattaattttattaaagag
ttaaaaaaaaaaataccaaatattgtttatatttattctgaaaatagtgcgaaaagtttt
ttgaaattcattaataattcaggcttgaaagatgattggatggatacaaacttaatgtgt
atgggcgaaaaagcatctacaatacttaatgagataaaatggaaaaaaatttttcttttt
aatcctggagaagaagagtttttgttatataaaatttaa

DBGET integrated database retrieval system