KEGG   Alpha proteobacterium HIMB5: HIMB5_00014500Help
Entry
HIMB5_00014500    CDS       T02250                                 

Definition
alcohol dehydrogenase family protein with GroES-like domain,Zinc-binding dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:apm01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apm00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:apm00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:apm00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:apm00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:apm00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1325673..1326734
Genome map
AA seq 353 aa AA seqDB search
MKAQVLHKYDPEMKEQTWVTNKEMPDPKIEKASDVIVKIGAAGVCRTDLHIIEGVWKHIQ
DPDGELLPCVMGHENAGWIEDVGKDVTEFKKGDPVILHPLISGTDGTCLDCRRGNDMHAA
AGAFPGLSIKEGGYSELLKTSVRNLIKLPKVLAPKDVAPFSDAGLTAYRVVKKATRHLLP
GQSCTIIGAGGLGHIAIQCLKAMCAADIIIVEKSEKALKHAMELGGDHGVLIDGNEIEKV
KELTKGKGSEAVIDFVGEKGSTAMGIQMTSNGGFYYIVGYGEEIKSLAVDLIISEKTIVG
NLVGTWSELYELMELADRGKVKLSMQEYKLDDANKALHDLNEGKVKGRAVLVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcaagttttacataagtatgacccagagatgaaagaacaaacctgggtgact
aataaagaaatgcctgatccaaaaattgaaaaggcttctgatgtaattgtaaaaattggt
gctgcaggggtttgcagaactgatctacatattattgaaggagtttggaaacatattcaa
gatccagatggtgagttattaccatgtgtaatgggtcacgaaaatgcaggttggattgag
gatgttggtaaagacgttactgaatttaaaaaaggtgatccagtaattcttcacccattg
atttcaggaacagatggtacctgcttagattgcagaagaggaaatgatatgcacgctgca
gcaggtgcatttccaggtttaagtattaaagaaggtggatattctgaattattaaaaaca
agtgttagaaatctaatcaaacttccaaaagttttagcaccaaaagatgttgcgcctttt
tctgatgctggcttgactgcttacagagtagttaagaaagctacaagacatttgctacca
ggtcaaagctgtacgataattggagctggtggtttaggacatattgcaattcaatgttta
aaagcaatgtgtgctgcagacatcattattgtagaaaaatctgaaaaagcgttgaaacat
gcaatggaacttggtggtgatcacggagttttaattgatggtaatgaaatcgaaaaagta
aaagaacttacaaaaggaaaaggttctgaagctgtaatcgattttgttggtgaaaaagga
tctacagccatgggaattcaaatgacttctaatggtggtttttattacattgttggatat
ggagaagaaattaaatcactagcagttgatttaattatttctgagaaaacaattgtaggt
aatttagtaggaacgtggtctgagttatatgaattgatggaattagctgacagaggaaaa
gttaagctatctatgcaagaatataaattagatgatgctaacaaagcacttcatgactta
aacgaaggaaaagttaaaggtcgtgcagtcttagttccataa

DBGET integrated database retrieval system