KEGG   Alpha proteobacterium HIMB5: HIMB5_00014500Help
Entry
HIMB5_00014500    CDS       T02250                                 

Definition
alcohol dehydrogenase family protein with GroES-like domain,Zinc-binding dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
apm  Alpha proteobacterium HIMB5
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:apm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    HIMB5_00014500
Enzymes [BR:apm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     HIMB5_00014500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1325673..1326734
Genome map
AA seq 353 aa AA seqDB search
MKAQVLHKYDPEMKEQTWVTNKEMPDPKIEKASDVIVKIGAAGVCRTDLHIIEGVWKHIQ
DPDGELLPCVMGHENAGWIEDVGKDVTEFKKGDPVILHPLISGTDGTCLDCRRGNDMHAA
AGAFPGLSIKEGGYSELLKTSVRNLIKLPKVLAPKDVAPFSDAGLTAYRVVKKATRHLLP
GQSCTIIGAGGLGHIAIQCLKAMCAADIIIVEKSEKALKHAMELGGDHGVLIDGNEIEKV
KELTKGKGSEAVIDFVGEKGSTAMGIQMTSNGGFYYIVGYGEEIKSLAVDLIISEKTIVG
NLVGTWSELYELMELADRGKVKLSMQEYKLDDANKALHDLNEGKVKGRAVLVP
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcaagttttacataagtatgacccagagatgaaagaacaaacctgggtgact
aataaagaaatgcctgatccaaaaattgaaaaggcttctgatgtaattgtaaaaattggt
gctgcaggggtttgcagaactgatctacatattattgaaggagtttggaaacatattcaa
gatccagatggtgagttattaccatgtgtaatgggtcacgaaaatgcaggttggattgag
gatgttggtaaagacgttactgaatttaaaaaaggtgatccagtaattcttcacccattg
atttcaggaacagatggtacctgcttagattgcagaagaggaaatgatatgcacgctgca
gcaggtgcatttccaggtttaagtattaaagaaggtggatattctgaattattaaaaaca
agtgttagaaatctaatcaaacttccaaaagttttagcaccaaaagatgttgcgcctttt
tctgatgctggcttgactgcttacagagtagttaagaaagctacaagacatttgctacca
ggtcaaagctgtacgataattggagctggtggtttaggacatattgcaattcaatgttta
aaagcaatgtgtgctgcagacatcattattgtagaaaaatctgaaaaagcgttgaaacat
gcaatggaacttggtggtgatcacggagttttaattgatggtaatgaaatcgaaaaagta
aaagaacttacaaaaggaaaaggttctgaagctgtaatcgattttgttggtgaaaaagga
tctacagccatgggaattcaaatgacttctaatggtggtttttattacattgttggatat
ggagaagaaattaaatcactagcagttgatttaattatttctgagaaaacaattgtaggt
aatttagtaggaacgtggtctgagttatatgaattgatggaattagctgacagaggaaaa
gttaagctatctatgcaagaatataaattagatgatgctaacaaagcacttcatgactta
aacgaaggaaaagttaaaggtcgtgcagtcttagttccataa

DBGET integrated database retrieval system