KEGG   Arthrobacter phenanthrenivorans: Asphe3_00690Help
Entry
Asphe3_00690      CDS       T01435                                 

Definition
pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:apn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:apn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:apn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apn00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(68773..70221)
Genome map
AA seq 482 aa AA seqDB search
MGEFRMPSLGADMDHGKMVEWLVKPGDYVHRGDVVAVVDTDKTVMDIETFEEGVVAELLV
DIGTTVPIGTPLARITATPDDGTAPPAPGAPQEARMENHALVSPPVRHLAHQLGVDPAAI
RGTGKHGAVTRADVEHAAAPSGAPGDTARQAGQEAMPAAAAARPGRVRSSPRARRLAAER
GLDIASLAGSGPGGAVTEDDVLRAPAAIAPTGPEPAGQAATATEETAPGQIPPEPAGQDQ
AGQEAAPAPAVAAVPAAEGREREAGLRRAVGALMSKSKKTIPHYYLSSTLDMGPAMAWMQ
SVNLQRPVSARLVPSALLLKAAALAAKAVPEVNGFYLDDEFRPSSSVHLGVAVALRKGGI
VAPAIHDADQLTVDALMERLRDLVGRARAGRLQRAEMADPTITVTNLGELGVDSVFGVIY
PPQVAMVGLGRVMEQAWAHDGMLGVRPVVTATLSADHRVSDGLRGARYLAQLDELLQKPE
EL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgagttccggatgccgtccctgggggcggacatggaccacggaaagatggtggag
tggctggtcaaacccggcgactacgtccaccgcggcgatgtggtggccgtggtggacacg
gacaagaccgtcatggacatcgagaccttcgaggaaggagtggtggccgagctcctggtg
gacatcggcaccaccgtcccgatcggcactccgctcgcccgcatcacggcaacccctgac
gatggaacggcaccgcccgcgcctggagctccgcaggaagctcgcatggagaaccacgcg
ctggtttcacccccggtgcgccacctcgcccaccagctgggagtggaccctgcggccatt
cggggcaccgggaagcatggtgcggtgacacgtgccgacgtggagcatgccgcagccccg
tcgggggcaccaggggacacagcgcggcaggccgggcaggaagccatgcccgctgcggca
gccgcccggcccggccgcgtgcggtcgtcgccgcgtgcacggcggctcgctgccgagcgt
ggactggacatcgcctcgctggctggaagcggtcccggcggcgccgttacggaggacgac
gtcctccgggccccagctgccattgcccccactggcccggagcctgctggacaggccgcc
actgcgaccgaggaaaccgcaccgggccagatacccccggaacccgcagggcaggatcag
gcagggcaggaggcagcgcctgcaccggcggtagcggctgtccccgccgcggagggccgt
gagcgcgaggcgggcctgcgccgggcagtcggcgctttgatgtccaagtccaagaagacc
atcccgcactactacctcagcagcacgctggacatgggcccggccatggcttggatgcag
tcagtcaacctgcagcgccccgtgtccgcgcggctggtgccgtctgcgctgctgctgaag
gcagccgccctcgcggcgaaagcagttccggaggtcaacgggttttacctggacgacgag
ttccgtcccagcagttcggtacacctcggcgttgccgttgccttgaggaaagggggcatc
gtggcgcccgccatccatgacgcggaccaactgaccgtcgacgccctgatggagcggctg
cgggacctcgttggacgggcccgggcgggaaggctgcagcgggccgaaatggcagatccc
accatcaccgtcaccaacctgggcgagctcggagtggacagcgtgttcggggtgatctat
cccccgcaggtggccatggtgggactcggcagggtcatggagcaggcgtgggcccacgac
gggatgttgggcgtacgcccggtggtcaccgcaacgctctcggcggaccaccgggtcagc
gacggcctgcgcggcgcccgctacctggcacaactggacgagctgctgcagaaaccggag
gagctgtga

DBGET integrated database retrieval system