KEGG   Arthrobacter phenanthrenivorans: Asphe3_01510Help
Entry
Asphe3_01510      CDS       T01435                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
apn  Arthrobacter phenanthrenivorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
155696..156841
Genome map
AA seq 381 aa AA seqDB search
MRTTRPLLASVLALASVVIIPSTAFAAPAPPSDPKASEHSSVISENSLRALADEAGIKIG
VAVNADLLEQNGKYRNIVNTQYSSVTAENVMKWEALNPAPGVYDWAAAEALIANAEANGQ
VVRGHTLVWHNQLPTWLTTGDYSAEELRVILENHVRTVAGHFAGDIQQWDVVNEIFNDDA
EGSFRETVWYQAYEELGLPGEQYVADVFRWAHEADPNALLFYNDYNLEFTGPKSNAAYAF
VQELLADGVPIHGVGFQGHLDTQYGYPDLRNNLQRFADLGLEVALTEVDIRTYVAQKPNG
TYTNTPVDPAEADQQVDWWAQTLEDCLAVEACNSYTVWGVSDANSWIPGWFTGQGAGLLY
DMHNNPKPQYEALLEVLRDAA
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacaactcgtcccctactcgcaagcgtcctggcgctggcctctgtggtgatcatc
ccgagcaccgccttcgctgctccggctccgccgtcagacccgaaggcgtcagagcactcg
tccgtcatcagtgagaacagcctgcgcgccctcgccgacgaagccggcatcaagatcggt
gttgccgtgaatgccgatctgctggaacaaaacggcaagtaccgcaacatcgtcaacacc
cagtactccagcgtcaccgccgagaatgtaatgaagtgggaggccctgaacccggctccc
ggcgtttacgactgggccgcagcggaggcgctgatcgccaacgccgaggcgaacggccag
gtcgtacgggggcacaccctcgtgtggcacaaccagctgcccacttggctcacgacgggg
gattacagcgccgaggagctgcgcgtcatcctggagaaccacgtccggacagtcgccggg
cacttcgcaggcgacatccagcagtgggacgtcgtcaacgagatcttcaacgacgacgcc
gagggtagcttccgcgagaccgtttggtaccaggcatacgaggaactcggcctgccgggc
gagcagtacgtcgccgacgtcttccgctgggcgcacgaggccgacccgaatgcgctgctc
ttctacaacgactacaacctggagttcactggccccaagagcaacgccgcgtatgccttc
gtgcaggaactgctcgcggacggggtgccgatccacggtgtcggcttccaggggcacctc
gacacgcagtacggctaccctgacctgcgcaacaacctgcagcgattcgccgacctgggt
ctggaggtcgcgttgactgaggtcgacatccggacctacgtcgcccagaagccgaacggc
acctacaccaacaccccggtggaccctgccgaggcggaccagcaggttgactggtgggca
cagaccctcgaggactgtctcgcggttgaggcgtgcaactcgtacacggtatggggtgta
tcggacgcgaattcctggatcccgggctggttcaccggccagggcgcaggcctgctgtac
gacatgcacaacaacccgaagccacagtacgaggcgctgctcgaggttctgcgcgacgca
gcctga

DBGET integrated database retrieval system