KEGG   Arthrobacter phenanthrenivorans: Asphe3_02900Help
Entry
Asphe3_02900      CDS       T01435                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Asphe3_02900
Enzymes [BR:apn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Asphe3_02900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
305711..306355
Genome map
AA seq 214 aa AA seqDB search
MTHFDDDDVPASAGYPAEGGADHSKHQKVDRPRIEAAVREILLAIGEDPDRGGLVDTPKR
VAKAYAEVFAGLHHDPADVLSTTFDLDHEELVLVKDIPFYSTCEHHLVPFHGVAHVGYIP
SHDGKVTGLSKLARLVDIYARRPQVQERLTTEIVEAMVRYLKPRGAIVVVECEHMCMSMR
GIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgacccacttcgacgacgacgacgttcccgcctccgccggatacccggcggagggcggc
gccgaccattcaaagcaccagaaggtggaccggccccgcatcgaggctgccgtccgcgag
atcctccttgccatcggagaagaccccgaccgcggcggcctggtggacacccctaaaagg
gtggccaaggcctacgccgaggtgttcgccggcctgcaccacgaccccgccgacgtcttg
tccaccaccttcgacctggaccatgaggaactggtcctggtcaaggacatcccgttctac
tccacgtgcgagcaccacctggtgccgttccacggagtggcccacgtgggctacattccg
tcccacgacggcaaggtgacggggctcagcaagctggcccggctcgtggacatttatgcg
cgccggccgcaggtgcaggagcgcctcaccactgagatcgtcgaggcgatggtccgctac
ctcaaaccccgtggcgccatcgtcgttgttgaatgcgaacacatgtgcatgtcaatgcgc
ggtatccgcaagcccggagcgaagaccgtcaccagcgcggtccgcgggcagcttcatgac
ccggccacccgtgccgaagccatgagcctcatcctcggaaggtaa

DBGET integrated database retrieval system