KEGG   Arthrobacter phenanthrenivorans: Asphe3_02910Help
Entry
Asphe3_02910      CDS       T01435                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Asphe3_02910
Enzymes [BR:apn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Asphe3_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
306366..307286
Genome map
AA seq 306 aa AA seqDB search
MDSLAAAPGTGPATSPLPVLRRPRPAARFEDLPTGRTLVMGILNVTPDSFSDGGRHATAD
TAIVAGLRMFYAGADIIDVGGESTRPGAEDVSPEEEQQRVVPVIEALVKAGALVSIDTTH
ASTAAAAIKAGAAIINDISGLSIEPEMAELVAASKVPYILTHRRGDARTMNSLAEYKDVA
GEVVAELAGVRDKLYAAGVSREQIIVDPGLGFAKNDAQNWELLQNLDQLDSLGHPVLVGA
SRKRFLGTLLTVAGKSAAPEERDGATAAITAISAYRGAWAVRVHDVGPSLDAVKVASRMA
APRAGS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggattcactagctgcagccccgggaaccgggcccgcaacctccccgctgcccgtactg
cgcagaccgcgcccggcagcccgctttgaagacctgcccaccggccgcaccctggtcatg
ggaatcctgaacgtcaccccggactccttcagtgacggcggcaggcatgccacggcggac
actgccatcgtggcagggctccggatgttctatgccggggcggacatcatcgatgttggt
ggcgaatccacccgtcccggggccgaggacgtcagcccggaagaggaacagcagcgcgtc
gtccccgtcatcgaggcattggtgaaggcgggggccctggtcagtatcgacaccacccac
gcttccacggcggccgctgccatcaaggccggcgccgccatcatcaatgacatctccggg
ctcagcatcgagccggagatggcggaactcgtggcggccagcaaggtcccgtacatcctc
acgcaccgccgcggcgacgcccgcaccatgaattcgcttgccgagtacaaggatgtggcg
ggggaagtggtggccgaactcgccggcgtgcgggacaagctgtatgccgccggcgtgagc
cgggagcagatcatcgtggaccccggcctggggttcgccaagaacgacgcccagaactgg
gagctcttgcagaacctggaccagttggacagcctgggacaccccgtcctggtgggagcc
tcacgcaagcggttcctgggcacgctgctgacggtggccggcaagtccgccgccccggag
gagcgcgacggcgccaccgccgccatcactgccatcagcgcctaccgcggcgcctgggcc
gtgcgcgtgcacgacgtcggccccagccttgacgctgtcaaggtcgcctcgcgcatggcc
gcgccacgcgccggcagctag

DBGET integrated database retrieval system