KEGG   Arthrobacter phenanthrenivorans: Asphe3_02930Help
Entry
Asphe3_02930      CDS       T01435                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Asphe3_02930
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Asphe3_02930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
307697..308242
Genome map
AA seq 181 aa AA seqDB search
MNSGYSKAVLALGSNLGERNDTLSGAVADLVDPPEVRLLAVSPVVQTKAVGGPPGQPDFL
NMVITVETSLTPQELLAHCQAVENKHHRVREVRWGPRTLDVDIITYGTLRSDDPDLTLPH
PRAASRAFVLYPWSLIEPAATLDGERISTLAARADDFDDLAPFDGFGDFDGMPTAGAVEE
R
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcggttattccaaggcggtgcttgcgctcggcagcaatctgggtgagcggaac
gacaccctctccggcgccgtggcggacctggtggacccgccggaagtccggctcctggcg
gtctcccctgtcgtacagacgaaggccgtgggcgggccgcccggccagcccgacttcctg
aacatggtcatcacggtggaaaccagcctcactccgcaggaactgctggcccactgccag
gctgtggagaacaaacaccaccgggtgcgcgaggttcgctggggtccgcgcaccctcgac
gtggacatcatcacctacgggacgctgcgcagcgacgaccctgacctcaccctgccgcat
ccccgtgccgcgagccgggcgttcgtgctttacccgtggtcgctgatcgagcctgccgcc
accctggacggggagcgaatcagcacgctcgccgcccgggcagacgactttgacgacctt
gccccgttcgacggcttcggcgacttcgacgggatgcccacagcgggagcagtggaggag
cgatga

DBGET integrated database retrieval system