KEGG   Arthrobacter phenanthrenivorans: Asphe3_03920Help
Entry
Asphe3_03920      CDS       T01435                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Asphe3_03920
Enzymes [BR:apn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Asphe3_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
406807..409041
Genome map
AA seq 744 aa AA seqDB search
MTASDQQHSDRPGTPADPPRVPSGNAAAAAGTVDPHLLQRLADAHGVGTSFQGWDGLPHS
VAEATLIKVLAALGVKADTNQAIEAALAEAELAPWRRVLPPAVVIQQGEPALVPVHVPEG
AAVSLTIALEDEGGTLEGVQQDVQVQSVDVDGVATGRATFALPEDLPLGWHTMTAEAGSV
KASAVLVVTPRRLTTAAPLEQRRGWGLATQLYSVRSRRSWGIGDFSDLADLAALSGARGA
DYVLVNPLHAAEPVPPVQPSPYSPSTRRFFNPLYIRVEAIPELAYLKPRKRAAVEKLHEE
VSSLNREGGRLDRNAVYAAKLQALEMLYHARRSPARQAAFDEFCRISGRGLDDFALWSAI
REDVAPGDPLWKDPSSALGTAKAEALREKLADRIGFHRWLQWICDEQLEEAQKAALRAGM
RLGVVHDLAVGVDHSSADAWTLRDVLAPATSVGAPPDMYNQQGQDWGQPPWHPARLAEAG
YQPFRNMLATVLRHAGGIRVDHILGLFRLWWIPVGNAPGDGAYVRYDHEALIGILALEAQ
RAGAVVIGEDLGTFEPWVRDYLAARGILGTSILWFEYDGDSPLAPEKYRTQALASVNTHD
LPPTAGYLAGDHVALRSGLGLLERSEEEERAEHNAALEKMLALVRERGYLPGKAAGGPGE
TEEQTIEALHLLLTQTPSVLLGVALVDAVGERRVQNQPGTSEALYPNWQVPLGGPDGKPV
FLDDLPANTRFNSLLKAVEEALHG
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgacggcttcagaccagcagcattcagatcgtccaggcacgccagcagatcctccgcgc
gttccatcaggcaacgccgctgctgccgccgggactgttgacccgcacctgctgcaaagg
ctggcggacgcgcatggagtgggcacctccttccagggctgggacgggctgccgcattcc
gtggccgaggctaccctgatcaaggtcctggctgccctgggcgtgaaagcggacaccaac
caggccatcgaggcggccttggccgaagcggaacttgcgccctggcggcgggtgctgcct
cccgccgtcgtcatccagcagggcgagccggcgctggtcccggtccatgtgcccgagggc
gcagctgtcagcctcaccattgccctggaagatgagggcggcaccttggaaggggtgcag
caggacgtccaggtacagtctgtggatgtcgacggcgtcgccacaggacgtgccaccttc
gccctcccggaggacttaccgctgggctggcataccatgaccgccgaggccggcagcgtg
aaggcttcagccgtgctggtggtgacgccgcggcggctgaccacggcggctccgcttgaa
cagcggcggggctggggactggctacgcagctctattccgtgcgctcccgcaggtcctgg
ggaatcggtgacttctccgaccttgcagaccttgctgcgctgagcggagcccgcggcgcc
gattacgtgctggtgaacccgctccacgcggccgagccggtccctccggtgcagccatcg
ccctactcgccgtccacccgccgcttcttcaatccgctctacatccgggtggaggccatc
cccgagctggcctacctgaagccgcgcaagcgcgccgcagtggaaaagctgcacgaggaa
gtttccagtttgaacagggagggcggccggctggaccggaacgccgtctatgcggcgaaa
ctccaggccctggagatgctgtaccacgcacgccggtccccggcgcggcaggcggccttt
gatgagttctgcaggatctccgggcgtggactggacgactttgccctgtggtccgccatc
cgtgaggatgtcgccccgggcgatccgctgtggaaggacccttcttctgccttgggcaca
gcgaaggccgaggcgctgcgggaaaagctcgcggacaggatcgggttccaccggtggctg
cagtggatctgcgatgagcagctggaggaggcccagaaggcggcgctgcgtgcgggcatg
aggctgggcgtggtgcacgatcttgccgtgggagtggaccacagcagtgccgatgcctgg
acgctgcgagatgtactggctcccgccaccagcgtgggcgccccgcccgacatgtacaac
cagcagggccaggactggggacagccgccatggcatccggcccgcctggctgaggccgga
taccagccgttccggaacatgctggccacggtgctccggcacgccggcggcatccgggtg
gaccacatccttggcctcttccggctgtggtggattccggtcggaaacgccccgggagac
ggcgcctacgtccgctatgaccacgaggccctgatcggcatcctggccctggaggctcag
cgcgccggcgccgtggtgattggcgaggacctgggcaccttcgagccgtgggtgcgtgac
tacctggccgcccgcggcatcctgggcacgtccatcctgtggttcgagtacgacggcgac
tcgccccttgcgccggaaaagtaccggacgcaggcactcgccagcgtcaacacccacgac
ctgccgcccaccgccggctatctcgcgggcgaccacgtggcgctgcgcagcgggctggga
ctgctggaacggtccgaggaagaggaacgcgccgagcacaacgcagcgttggaaaagatg
ctggcgctggtgcgggagcgtggctacctgcctgggaaagcggccggcgggccgggagaa
acggaagaacagaccatcgaggcgctgcacctcctgctgacccagacgccgtcggtattg
ctgggcgtagccctggtcgacgcggtgggggagcggcgggtccagaaccagcctggcact
tccgaagcgctttacccgaactggcaggttccgctgggcggccctgacggcaaacccgtg
ttcctggacgacctccccgccaacacccggttcaactcactgctgaaggcggtggaggag
gccctgcacggctag

DBGET integrated database retrieval system