KEGG   Arthrobacter phenanthrenivorans: Asphe3_05800Help
Entry
Asphe3_05800      CDS       T01435                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:apn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Asphe3_05800
DNA repair and recombination proteins [BR:apn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Asphe3_05800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(591892..592491)
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQELIDELGRLPGVGPKSAQRLAFHILEADPQDMKRLVEAITTVKERVKFCTVCG
NVTEQELCNICRDPRRDPAVICVVEESKDVLAVERTRSFRGRYHVLGGAINPIAGIGPEQ
LRIRELLTRLNDGAIQEVIIATDPNLEGEATATYLARMLKTIGITVTRLASGLPVGGDLE
YADEVTLGRAFEGRRNALA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtgcagtccaggagctgattgatgagctcggccgccttccgggggtgggc
cccaaatccgctcagcggctggcgttccacatacttgaagccgacccgcaggacatgaag
cggctggtggaggccatcaccacagtcaaggagcgggtcaagttctgcactgtgtgcggc
aacgtcaccgagcaggaactgtgcaacatctgccgcgacccccgccgtgaccctgcagtc
atctgcgtggtggaggaatccaaggatgtcctggccgtggagcgcacccggtccttccgt
ggccggtaccacgtgctgggcggggccatcaaccccatcgccggcatcggtccggagcag
ttgcggatccgggaactgctgacccggctcaacgacggcgccatccaggaagtcatcatc
gccacggacccgaaccttgagggcgaagccactgccacctatctggcccggatgcttaag
accatcggcatcactgtgacccggcttgcctcgggcctgccggtgggcggagacttggag
tacgcggacgaggttacgctgggccgcgctttcgagggccgccggaacgccctggcatga

DBGET integrated database retrieval system