KEGG   Arthrobacter phenanthrenivorans: Asphe3_05890Help
Entry
Asphe3_05890      CDS       T01435                                 

Definition
glutathione peroxidase (EC:1.11.1.12)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Asphe3_05890
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Asphe3_05890
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Asphe3_05890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601026..601511
Genome map
AA seq 161 aa AA seqDB search
MTPLYPIPLTLNDGTATDFGRFEGKVVLVVNVASNCGFTPQYAGLEALYEKFRDRGFEVL
GVPCNQFAGQEPGSDSDIAEFCERNFGVTFALTVKADVRGRNQHPLYGELTKFKTGLLPG
LVKWNFEKFLVSRHGEVVGRFAPTVEPDSAEIIDAIEKELG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgacacccttgtacccgatcccactgaccctgaacgacggaaccgcgactgatttcggc
aggttcgagggcaaagtggtgctggtggtcaacgtggcgtccaactgtggttttacgccg
cagtacgcggggctcgaggcactgtacgaaaagttcagggaccgcgggtttgaggtcctg
ggcgtcccctgcaaccagttcgcggggcaggagcccggaagtgacagcgacatcgccgag
ttctgcgagcggaacttcggtgtgacgttcgccctcacggtcaaggccgacgtccgcggc
aggaaccagcacccgctctacggggagctcaccaagtttaagaccgggctgcttcccgga
ctggtcaagtggaacttcgaaaagttcctggtcagccggcacggcgaggtggtgggccgc
ttcgctcccaccgtggagccggactcggcagagatcatcgacgcgatcgaaaaagaactc
ggctga

DBGET integrated database retrieval system