KEGG   Arthrobacter phenanthrenivorans: Asphe3_06080Help
Entry
Asphe3_06080      CDS       T01435                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_06080
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Asphe3_06080
Enzymes [BR:apn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Asphe3_06080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(621664..622980)
Genome map
AA seq 438 aa AA seqDB search
MTAAFEPTQQTPEEQAAALELEWAANPRWEGVTRDYSASDVVRLRGRVSEEHTLARRGAE
KLWKQLTEEHKTGGYTNALGALTGNQAVQQVKAGLRAIYLSGWQVAADANNSGHTYPDQS
LYPANSVPTVVRRINNALLRADQIEFSEGIQTVEDWMVPIVADAEAGFGGPLNAYELMKS
MIQAGAAGVHWEDQLASEKKCGHLGGKVLIPTQQHVRTLNAARLAADVAGTPSVVIARTD
AEAATLITSDVDERDQEFITGERTAEGFYKVRNGIEPCIARAKAYAPYSDLIWMETGTPD
LELARKFAEAVKAEFPDQMLSYNCSPSFNWRKHLDDATIAKFQRELGAMGFTFQFITLAG
FHALNYSMFDLAHGYAREGMSAYVELQEKEFASESRGYTATKHQREVGTGYFDTISTALN
PNASTLALVGSTEEGQFH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagcatttgagcccacccagcagacgcccgaagagcaggccgccgccctggag
ctcgagtgggccgccaacccccgctgggaaggtgtgacccgggactactcagcctccgac
gtcgtccgtctccgcggccgcgtctccgaagaacacaccctggcccgccgcggcgccgag
aagctgtggaagcagctcaccgaggagcacaaaaccggcggctacaccaacgccctgggc
gccctgaccggtaaccaggccgtgcagcaggtcaaggccgggctgcgggccatctacctt
tccggctggcaggttgccgcggacgccaacaactccggccacacctacccggaccagtcg
ctttaccccgccaactcggtccccaccgtggtccgccggatcaacaacgccctgctccgc
gcggaccagatcgagttctccgaaggcatccagaccgttgaggactggatggtcccgatc
gtggcggacgccgaagccggcttcggcggcccgctgaacgcctacgagctgatgaagtcc
atgatccaggccggcgccgcgggtgttcactgggaggaccagctcgcctccgaaaagaag
tgcggccacctgggcggcaaggtcttgatccccacccagcagcacgtccggaccctgaac
gcggcccgtctggcggccgacgtcgccggtaccccgtcggtggtcatcgcccgtacggac
gctgaggcagccaccctgatcacctcagacgtcgacgagcgcgaccaggaattcatcacc
ggcgagcgcacggccgagggcttctacaaggtccgcaacggcatcgaaccctgcatcgcc
cgtgccaaggcctacgccccttattcggacctgatctggatggaaaccggcaccccggac
ctcgagctggcccgcaagttcgccgaagccgtcaaggccgagttcccggaccagatgctc
tcctacaactgctcgccgtcgttcaactggcgcaagcacctggacgacgccaccatcgcc
aagttccagcgtgaactcggcgccatgggcttcacgttccagttcatcaccctggccggc
ttccacgccctgaactactcgatgttcgacctcgcccacggctacgcccgggaaggcatg
agcgcctacgtcgagctgcaggaaaaggaattcgcctccgagtcccgcggctacaccgca
accaagcaccagcgcgaagtcggcaccggctacttcgacaccatctccaccgcgctcaac
ccgaacgcatccaccctcgcactggtcggatcgaccgaagagggccagttccactaa

DBGET integrated database retrieval system