KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_06720Help
Entry
Asphe3_06720      CDS       T01435                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00220  Arginine biosynthesis
apn00250  Alanine, aspartate and glutamate metabolism
apn00471  D-Glutamine and D-glutamate metabolism
apn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Asphe3_06720
   00220 Arginine biosynthesis
    Asphe3_06720
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Asphe3_06720
Enzymes [BR:apn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Asphe3_06720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: ADX71881
UniProt: F0MBJ9
Position
complement(689260..690096)
Genome map
AA seq 278 aa AA seqDB search
MTTALEAPPLRPLLDDLVCSHRPERETGSVPANIPFLSEVPFDRFGIAVATTSGEVFSSG
DAHVPFSIQSISKVFTLAMALQRDTTGTLWSRVLREPSGTAFNSLVQLEAEHGIPRNPFI
NAGALVVTDHLMEETSDAATWLLRFLTAEAGSSGPFIDEAAAASELSGSSRNLALAHFLK
DFGNLRPTAESVVENYVRQCSIMMTCAELAKAALFLAREGRGTLGPVLTPSDAKRIGSIM
LTCGMYDAAGEFAYRVGLPGKSGVGGGILVIVPGKCAI
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaccacagcactcgaggcgccaccgctccgcccactccttgacgacctcgtctgcagc
cacaggccggagcgggaaacaggatcggtccctgcgaacatcccgttcctgtcagaagtt
cccttcgacaggttcggcatagctgttgccaccacgtccggtgaggtgttcagctccggt
gacgcccacgtcccgttctccatccagagcatttccaaggtgtttacactggcaatggca
ctccagcgcgacaccacgggaacgttgtggtcccgggtactgcgggaaccctccggaacc
gcgttcaactccctggtccagctggaggctgaacacgggatcccgcggaaccccttcatc
aacgccggcgccctggtggtcacggaccacctcatggaggaaacgtccgacgccgccacc
tggcttctgcggttcctcaccgcggaggcgggcagcagcgggccgttcatcgacgaggcc
gcggcggccagtgagctttcaggcagcagccgcaacctggcgctggcgcacttcctcaag
gacttcgggaacctgcggccgaccgcggaatccgtggtggaaaactacgtccgccagtgc
tccatcatgatgacctgcgccgagctcgccaaagcggcgctcttcctggcacgggaaggc
cggggaacactcggtccggtcctgacccccagcgatgcaaaacgcatcggctccatcatg
ctgacctgcggcatgtacgacgccgccggagaattcgcctaccgcgtgggcctgcccggc
aagagcggtgttggcggaggaatcctggtcatcgttcccggtaagtgcgccatctga

DBGET integrated database retrieval system