KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_07600Help
Entry
Asphe3_07600      CDS       T01435                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00010  Glycolysis / Gluconeogenesis
apn00260  Glycine, serine and threonine metabolism
apn00680  Methane metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01200  Carbon metabolism
apn01230  Biosynthesis of amino acids
Module
apn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
apn_M00002  Glycolysis, core module involving three-carbon compounds
apn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_07600
  Energy metabolism
   00680 Methane metabolism
    Asphe3_07600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_07600
Enzymes [BR:apn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Asphe3_07600
Membrane trafficking [BR:apn04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Asphe3_07600
Exosome [BR:apn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Asphe3_07600
  Exosomal proteins of melanoma cells
   Asphe3_07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADX71963
UniProt: F0M180
Position
786658..787404
Genome map
AA seq 248 aa AA seqDB search
MTYKLILLRHGHSEWNAKNLFTGWVDVDLNDQGRQEAARGGELLVENEVLPDIVYTSLLK
RAINTANIALDKADRGWIPVKRDWRLNERHYGALQGKDKAQTLAEYGEEQFMEWRRSYDT
PPPPLDDDSEFSQAHDPRYADLGDALPRTECLKDVLVRLLPYWESDIKEDLKAGKTVLVT
AHGNSLRALVKHLDGISDEAIASLNIPTGIPLVYDLDENFQPIKPGGTYLDPEAAEQAIL
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaagctgattctgctgcgccatggccacagcgaatggaacgccaagaacctg
ttcaccggctgggtggacgttgacctcaacgaccagggccgccaggaagcagcacggggc
ggggaactcctggttgagaacgaggttctcccggacatcgtctacacctcgctgctgaag
cgtgccatcaacacggcaaacatcgccctggacaaggccgaccgcggctggatcccggtc
aagcgcgactggcgcctgaacgagcgccactacggcgccctgcagggcaaggacaaggcc
cagaccctcgccgagtacggcgaagagcagttcatggagtggcgccgttcctacgacacg
ccgccgccgcccctggacgacgattccgagttctcccaggcccacgacccccgctacgca
gacctcggcgacgcccttccgcggaccgaatgcctgaaggacgtcctcgtgcgcctgctg
ccgtactgggagtcggacatcaaggaagacctcaaggccggcaagactgtcctggtcacc
gcccacggcaactcgctccgcgccctggtcaagcacctggacggcatcagcgacgaagcc
atcgccagcctcaacatccccacgggcatccccctggtctacgacctcgacgagaacttc
cagccgatcaagcccggcggaacctacctcgacccggaagctgccgagcaggctatcctg
gccgtcgccaaccagggcaagaagtaa

DBGET integrated database retrieval system