KEGG   Arthrobacter phenanthrenivorans: Asphe3_07600Help
Entry
Asphe3_07600      CDS       T01435                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_07600
   01230 Biosynthesis of amino acids
    Asphe3_07600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_07600
  Energy metabolism
   00680 Methane metabolism
    Asphe3_07600
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_07600
Enzymes [BR:apn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Asphe3_07600
Exosome [BR:apn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Asphe3_07600
  Exosomal proteins of melanoma cells
   Asphe3_07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786658..787404
Genome map
AA seq 248 aa AA seqDB search
MTYKLILLRHGHSEWNAKNLFTGWVDVDLNDQGRQEAARGGELLVENEVLPDIVYTSLLK
RAINTANIALDKADRGWIPVKRDWRLNERHYGALQGKDKAQTLAEYGEEQFMEWRRSYDT
PPPPLDDDSEFSQAHDPRYADLGDALPRTECLKDVLVRLLPYWESDIKEDLKAGKTVLVT
AHGNSLRALVKHLDGISDEAIASLNIPTGIPLVYDLDENFQPIKPGGTYLDPEAAEQAIL
AVANQGKK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaagctgattctgctgcgccatggccacagcgaatggaacgccaagaacctg
ttcaccggctgggtggacgttgacctcaacgaccagggccgccaggaagcagcacggggc
ggggaactcctggttgagaacgaggttctcccggacatcgtctacacctcgctgctgaag
cgtgccatcaacacggcaaacatcgccctggacaaggccgaccgcggctggatcccggtc
aagcgcgactggcgcctgaacgagcgccactacggcgccctgcagggcaaggacaaggcc
cagaccctcgccgagtacggcgaagagcagttcatggagtggcgccgttcctacgacacg
ccgccgccgcccctggacgacgattccgagttctcccaggcccacgacccccgctacgca
gacctcggcgacgcccttccgcggaccgaatgcctgaaggacgtcctcgtgcgcctgctg
ccgtactgggagtcggacatcaaggaagacctcaaggccggcaagactgtcctggtcacc
gcccacggcaactcgctccgcgccctggtcaagcacctggacggcatcagcgacgaagcc
atcgccagcctcaacatccccacgggcatccccctggtctacgacctcgacgagaacttc
cagccgatcaagcccggcggaacctacctcgacccggaagctgccgagcaggctatcctg
gccgtcgccaaccagggcaagaagtaa

DBGET integrated database retrieval system