KEGG   Arthrobacter phenanthrenivorans: Asphe3_07770Help
Entry
Asphe3_07770      CDS       T01435                                 

Definition
alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:apn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
807266..811000
Genome map
AA seq 1244 aa AA seqDB search
MNQPILTPALISLLREWLPRQRWFPVKTPDFEVSQAGSLGLEDPSGHAGLEVFLLRVTTR
ASDGGQRTAVVQVPLSFRQAPAAGMERALVGQAAGMDPSRTWVYDAVHDPDFVGGWLELM
RQEEKAPSGTAAGFRVSAEQRLPTSRGVVKVLSGEQSNSSVIVDDGESAAIVKFFRVLSH
GTNPEVEVGAALTAAGTSEVPATLGWVRGEWLSENGAEPNESAAAQAGPRYVQGELAVAH
EFLAGGRDAWRLAVDAARSGTDFTAEAHALGEATATVHQRLAQALGQAVEPEPGQLIAPA
VAQRVRQAWAEARSAVGPYDDALDALLDRLDHAPAGPLQRIHGDLHLGQILQVPGQAGNP
ARWAILDFEGEPLRPVAERNVPDVPLRDVVGMLRSFDYAAGAAQREQEGAHVPATWVDDC
AEAFLAGYAGVTPGTVDRESPLFVALWLDKALYEVVYEMRNRPDWLAIPVNASRRLLNGN
GTGDHAGAASEGNEMTGSARTDRPGVPLQVDDGTLGRIANGEHHAPHSVLGAHLDDYGHV
TIRTVKHLAEAVTVITAAGETPMEHEAHGVWVAVIDPLQQGHVPDYRLAVTYPGAEPVTV
DEPYRYLPTVGEVDLHLIGEGRHEKLWEVLGAHVQHYKSSLGDVDGVSFAVWAPNAQAVR
VKGDFNAWDGRENSLRSLGSSGVWEIFIPGVVAGACYKFEIRTRAGHWVEKADPLAFGTE
VPPLTASKVVEPSYAFKDQEWMEARAKRDPHNSAMSVYEVHLGSWRLGLGYRELAKELVD
YVKWLGFTHVEFMPVAEHPFGGSWGYQVTSYFAPTSRFGHPDEFRYLVDTLHQAGIGVLL
DWVPAHFPKDAWALAQFDGEPLYEHADPNLGEHPDWGTLIFDFGRTEVRNFLVANALYWL
DEFHIDGLRVDAVASMLYLDYSRQDGQWQPNRFGGRENLEAISFLQEANATVYKTHPGAV
MIAEESTAFPGVTGPTSHGGLGFGLKWNMGWMHDSLKYISEDPVNRKWHHGTVTFSLVYA
FTENFLLPISHDEVVHGKGSMLRKMPGDRWQQLANLRAFLAYQWAHPGKQLIFMGTEFGQ
EAEWSEQHGLDWWLADIPAHQGVQLLTKDLNELYRSTPALYTRDNEPGGFQWINGGDADR
NVLSFIRWDNDNNPLVCAINFSGAPHAGYTLGVPQAGTWKEVLNTDATTYGGSGVLNSGE
LKATAHGQDGQPATLSVTLPPLGAAYFKPGAPAAGLKPGAPAAD
NT seq 3735 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcccatcctcacccccgccctgatttccctcctccgcgaatggctgccccgg
cagcgctggttcccggtcaagacacccgacttcgaggtctcccaggccggaagcctgggg
ctggaggacccctccggccacgcgggcctggaggtgttcctcctgcgcgtcaccaccagg
gcgtccgacggcggccagcggacggccgtggtccaggtcccgctgagcttccgccaagct
ccggcagccggcatggagcgggccctggtgggccaggcggccggcatggacccgtccagg
acctgggtctacgacgccgttcacgatcccgacttcgtgggcggctggctcgagctcatg
cggcaggaggagaaggcgccgagcgggacggccgccggcttccgtgtctcagcggagcag
cggctccccaccagccgcggggttgtgaaggtgctgtccggcgagcagtccaacagttca
gtcatcgtggacgacggcgagtccgccgccatcgtgaaattcttccgggtgctgtcccac
gggaccaacccggaagttgaagtaggtgcggcgctgacggcggcaggtacttccgaggtt
ccagcaacgctcggctgggtgcggggcgagtggctctccgagaacggggcggagcccaac
gaatccgcggcagcccaagccggcccgcgttacgtccagggcgaactggccgtggcccac
gaattcctggccgggggccgcgatgcgtggcggttggccgtggatgccgccaggtcgggc
acggacttcacggcggaggcccatgccctcggcgaggccacggcaaccgtgcaccagcgt
ctggcccaggccctgggacaggctgtcgaacccgagcccggccagttgattgctccagca
gtagcccagcgcgtccggcaggcatgggcagaagcccggtccgccgtcggcccctatgac
gacgccctggacgccctgctggaccggctggaccatgccccggcaggaccactgcagcgc
atccatggggacctgcacctgggccagatactccaggtgccagggcaggcgggaaacccc
gcacggtgggcgatcctggatttcgaaggcgaacccctgcgtcccgtcgccgaacgcaac
gttccggatgttcccctgcgggacgtcgtcggcatgctgcgttccttcgactacgccgcg
ggcgcggcacagcgcgaacaggaaggcgcgcacgtgcctgccacctgggtggacgactgt
gccgaggcctttctggccgggtacgcgggggtcactcccggcaccgtggaccgcgagtcc
cccctgtttgtggcattgtggctggacaaggcgctgtacgaagtagtttatgaaatgcgc
aacaggcccgactggctggcgatccccgtgaacgcctccaggcggctcctcaacggtaac
ggcaccggcgatcacgccggagcagcatcggaaggtaacgaaatgacaggctcagcacga
actgaccgcccaggggtgcccctgcaggtggatgacggcaccttgggtaggatagcgaac
ggtgaacaccacgccccccactcagtcctgggcgcgcaccttgacgactacggccacgtc
accatccgcaccgtaaagcacctcgccgaagccgtcaccgtcatcaccgcggccggcgag
actcccatggagcatgaagctcatggcgtttgggtagccgttatcgacccgctccagcag
ggccacgtcccggattaccgcctcgccgtcacctatccgggtgccgaaccggtcacagtg
gacgagccctaccgctacctgccgacagtaggagaagtcgacctccacctgattggggag
ggacggcacgaaaagctctgggaagtgcttggcgcacacgtccagcactacaaatcctcc
ttgggggacgtggacggtgtgtccttcgccgtctgggcgcccaatgcgcaggcggtccgg
gtcaagggcgacttcaacgcctgggacggacgcgaaaactccctccgctcacttggttcc
tccggcgtctgggaaatcttcattcccggggttgtggcaggggcgtgctacaaattcgaa
atccgcacccgggcaggacactgggtggagaaagccgacccgttggccttcggcaccgaa
gtacctccgctgactgcatcgaaggttgtggagccttcctacgccttcaaggaccaggag
tggatggaggcccgcgcgaagcgggatccgcacaactccgccatgagtgtctatgaggtg
cacctcggttcctggcgcctgggcctgggctaccgggaactggccaaggagctcgtggac
tacgtcaagtggctgggcttcacgcacgttgagttcatgcccgtggcagagcacccgttc
ggcggctcctggggctaccaggtcacttcctactttgcgcccacgtcccgcttcggccac
ccggatgagttccgctacctggtggacacgctccaccaggccggcatcggtgtcctgctg
gactgggtaccggcgcacttcccgaaggacgcctgggcgctcgcccagttcgacggcgaa
cccctgtacgagcacgccgaccccaacctgggcgaacacccagactggggcaccctgatc
ttcgacttcgggcgtaccgaagtcaggaacttcctggtggccaatgcgctctactggctg
gatgagttccatatcgacggactgcgcgtggatgctgtggcgtccatgctctatctcgac
tactcgcggcaggacgggcagtggcagcccaaccgcttcggcggcagggaaaacctggaa
gccatctcgttcctgcaggaagccaacgccacggtgtacaaaacgcacccgggtgcggtg
atgatcgccgaggaatccacggccttccccggcgtaaccggtcccaccagccacggcggc
ctgggatttgggctgaagtggaacatgggctggatgcacgactccctcaagtacatctcc
gaggacccggtcaaccgcaagtggcaccacggaacggtcaccttctccctggtttacgcc
ttcaccgagaacttcctgctgcccatcagccacgacgaggttgtacacggcaagggctcc
atgctgcgcaagatgcccggcgaccgctggcagcagctggccaacctccgcgcgttcctg
gcctaccagtgggcgcaccccggcaagcagctcatcttcatgggcacggagttcggccag
gaagccgagtggtccgagcagcacgggctggactggtggctcgccgacatcccggcgcac
cagggagtgcagctgctgaccaaggacctgaacgagctgtaccgttccacccccgccctg
tacacgcgggacaacgagcccggcggcttccagtggatcaacgggggagacgcggaccgc
aacgttctgtccttcatccgttgggataacgacaacaacccgctggtctgcgcaatcaac
ttctcgggagccccgcacgcgggttacaccttgggtgtcccccaggccgggacctggaaa
gaggtgctgaacacggacgcgacaacctacgggggatccggtgtcctcaactcaggcgaa
ttgaaggcaacggcccacggacaggacgggcagccggccacgttgagcgttaccctgccg
ccgctgggtgccgcttacttcaagccgggagcgccggccgcaggcttgaagccgggagcg
ccggccgccgactga

DBGET integrated database retrieval system