KEGG   Arthrobacter phenanthrenivorans: Asphe3_08540Help
Entry
Asphe3_08540      CDS       T01435                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_08540
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asphe3_08540
   00640 Propanoate metabolism
    Asphe3_08540
   00660 C5-Branched dibasic acid metabolism
    Asphe3_08540
Enzymes [BR:apn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Asphe3_08540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
892814..893983
Genome map
AA seq 389 aa AA seqDB search
MDLFEYQARDMFEAHGVPVLAGIVAYTPEEAKAAAEKIGGVTVVKAQVKVGGRGKAGGVK
VAKSADEAFEHATNILGMDIKGHTVKKVMIAQGADIAEEYYFSVLLDRANRNYLAMCSVE
GGMEIEQLAVERPEALAKIAIDPAVGIDQAKADEIVAAAGFPEELRGKVAAVILKLWDVF
KKEDATLVEVNPLVKTGAGEIVALDGKVSLDENAEFRHAKHALLEDKDAADPLEAKAKAQ
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGENHGNVKPANFLDIGGGASAEVMAAGLD
VILGDEQVKSVFVNVFGGITACDAVAKGIVGALAELGHTANKPLVVRLDGNNVEEGRRIL
NEANHPLVTLAATMDEGADKAAELANAAK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgtttgaataccaggcgcgcgatatgttcgaggcgcacggtgtacccgtgctt
gccggcatcgtggcgtacaccccagaagaagcaaaggcagctgccgagaagatcggcggc
gtaactgtcgtcaaagcgcaggtaaaggtcggcggccgcggcaaggccggcggcgtcaag
gttgctaagtccgcggatgaggcatttgaacacgccaccaacatcctgggcatggacatc
aagggccacaccgtcaaaaaggtgatgatcgcccagggcgcggacattgccgaggaatac
tacttctcagtcctgctggaccgggcaaaccgcaactacctggccatgtgctcggttgag
ggcggcatggaaatcgaacagctcgccgtcgaacgcccggaagccctggccaagatcgcc
atcgatcccgccgtgggcattgaccaggccaaggctgacgagatcgtcgcagccgcaggc
ttccccgaggaactgcgcggcaaggtcgccgccgtgatcctcaagctgtgggacgtcttc
aagaaggaagacgccaccctggtggaggtcaacccactggtgaagaccggtgccggcgaa
atcgtggccctggacggcaaggtctccctcgatgagaacgccgaattccgccacgccaag
cacgccctccttgaggacaaggacgctgccgatcccctcgaggccaaggcaaaggcgcag
gacctgaactacgtcaagctcgacggcgaagtaggcatcatcggcaacggcgccggcctg
gtcatgtccacgctcgacgtcgttgcctacgctggtgaaaaccacggcaacgtcaagccc
gccaacttcctggacatcggcggtggagcctccgccgaggttatggccgccggcctggac
gtcatcctgggtgacgagcaggtcaagtccgtgttcgtgaacgtctttggcggcatcacc
gcctgtgacgccgtcgccaagggcatcgtgggcgcgctggccgagctcggccacacagcg
aacaagccgctggtagtccgcctcgacggcaacaacgtcgaggaaggccgccggatcctg
aacgaggccaaccacccgctggtaaccctggccgccaccatggacgagggcgccgacaag
gccgccgagctcgccaacgcagcgaagtaa

DBGET integrated database retrieval system