KEGG   Arthrobacter phenanthrenivorans: Asphe3_09260Help
Entry
Asphe3_09260      CDS       T01435                                 

Definition
glutathione-independent formaldehyde dehydrogenase (EC:1.2.1.46)
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_09260
  Energy metabolism
   00680 Methane metabolism
    Asphe3_09260
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Asphe3_09260
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Asphe3_09260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
972711..973925
Genome map
AA seq 404 aa AA seqDB search
MTGNKAVAYKEPGKVEVIDIDYPSFELKDGPGVNPANVGRPVNHGVILKTVATNICGSDQ
HMVRGRTTAPPNLVLGHEITGEVVEVGRDVEFIKVGDLCSVPFNIACGRCRNCKERKTGI
CLNVNPDRPGSAYGYVDMGGWVGGQANYVLVPYADWNLLKFPDKDRAMEKIMDLAMLSDI
FPTGFHGAVSAGVGVGSTVYVAGAGPVGLAAATSAHLLGAAVVIVGDLNEERLARARGFG
CETVDLTKGDPKDQIEQILGVPEVDCGVDAVGFEARGHGKDASHEAPATVLNSLMDITAA
GGALGIPGLYVTGDPGGIDEAAKKGSLSLSLGTGWAKSLSFTTGQCPVMKYNRQLMMAIL
NDRVSIAKNVNAKAITLEEAPQGYAEFDAGAATKYVLNPNGYLS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgacagggaacaaagccgttgcctacaaagaaccaggcaaggttgaagtaatcgacatc
gactatcccagctttgagctcaaggacgggccgggcgttaacccggcgaatgtggggcgt
ccggttaatcacggcgtcatcctcaagacagtggccaccaacatctgcgggtctgaccag
cacatggtgcgcgggcggaccacggcaccgcccaacctggtgctcggccacgaaattacc
ggcgaagtggtggaggtgggccgcgacgtcgaattcatcaaagtcggcgacctctgttcc
gtgccgttcaatatcgcgtgcggccgctgccggaactgcaaggagcgcaagaccggcatc
tgcctgaacgtgaatccggaccgcccgggcagcgcctacggctacgtggacatgggcggc
tgggtgggcggccaggccaactacgtgctggtgccctacgccgactggaacctgctgaag
ttcccggacaaggacagggccatggagaaaatcatggacctggccatgctctcggacatc
ttccccacaggtttccacggtgcggtcagcgcaggcgttggcgtcggctccaccgtgtac
gtggcgggagcgggtcccgtgggcctcgcagcggcgacgagcgcgcacctgctgggtgcc
gccgtcgtgattgtcggagacctgaacgaggaacggctggcgcgggcgcgcggcttcggc
tgcgaaacagtagacctcaccaagggcgatccgaaggaccagattgagcagatcctgggt
gtgcctgaggtggactgcggtgtggacgccgtagggttcgaggcccgggggcacggcaag
gacgcctcacacgaagccccggccaccgtgctgaattccctgatggacatcaccgctgca
ggcggtgccctcggcatcccgggcctgtacgtgacgggcgatccgggcggcatcgacgag
gccgccaagaaggggtctctgagcctcagccttggcaccggctgggcgaagtcgctgagc
ttcaccaccggccagtgcccggtgatgaagtacaaccggcagctgatgatggccatcctc
aacgacagggtgagcatcgccaagaacgtgaacgcgaaggcgatcacgcttgaggaagcg
ccgcagggctacgccgagttcgacgccggcgcggcaacaaagtacgtcctcaacccgaac
ggctacctgagctag

DBGET integrated database retrieval system