KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_10200Help
Entry
Asphe3_10200      CDS       T01435                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Asphe3_10200
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Asphe3_10200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB XdhC_C
Motif
Other DBs
NCBI-ProteinID: ADX72204
UniProt: F0M3I5
Position
complement(1072288..1073157)
Genome map
AA seq 289 aa AA seqDB search
MNTTRPAVTVVGSINLDLIATAERLPTAGETIGGAVLSEQPGGKGANQAAAAARLGGSAR
MVGAVGHDASGQRMLDALDAAGVDTFDVAVLPQPTGTALIVVDRDGENQIVVCPGANAHL
SLDGVEFGPEETVLCQLEVGLEVVLEAARKAQGFFVLNAAPAMDLPAELLERCDLVIVNE
SEYALIPTLAEAKLVAVTYGKDGSAMFEHGRKVAEAPSAAVSVANTVGAGDAFCAALVLA
LGSGLDYSRALAVANAVGADAVGDPSSQPDLAQLGHYVERTAAASGASS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaacacgtcctgccgtcaccgtggtcggcagcatcaacctggacctgatcgcc
accgccgagcggcttccgacggcgggtgaaaccatcggcggcgccgtcctgtccgagcaa
cccggcggcaagggcgccaaccaggccgcggccgcggcacggctgggtggcagcgcccgg
atggtcggcgccgtgggtcacgatgcgtccgggcagcggatgctggacgccctggatgct
gccggcgttgacaccttcgacgtggccgtcctgccccagccgaccgggaccgccctgatt
gtggtggaccgcgacggcgagaaccagattgtggtgtgcccgggcgccaacgcgcatctg
tccctggacggggtggagttcggcccggaagaaacggtcctgtgccagctggaggtcggc
ctggaggtggtgctggaggcggcccggaaggcgcagggtttctttgtgctgaacgcggcg
ccggccatggacctgccggcagagctgctggagcggtgcgacctggtgatcgtcaacgag
agcgagtacgccctgatccctaccctcgcggaggcgaagctggtggcagtgacgtacggc
aaggacggctcggcgatgttcgagcacgggcgaaaggtggccgaggcgccctctgctgct
gtttccgtggcgaacaccgtgggcgcgggcgacgcgttctgcgccgccctggtcctggcg
ctggggagcgggctggactactcccgggctctggctgtggccaatgctgtgggtgcggat
gccgtgggtgatccgtcgtcccagccggatttggcacagctgggccactacgtagagcgg
acggctgccgcttcgggcgcttcctcgtga

DBGET integrated database retrieval system