KEGG   Arthrobacter phenanthrenivorans: Asphe3_10410Help
Entry
Asphe3_10410      CDS       T01435                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K18382  
NAD+-dependent secondary alcohol dehydrogenase Adh1 [EC:1.1.1.-]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Asphe3_10410
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Asphe3_10410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1093659..1094693)
Genome map
AA seq 344 aa AA seqDB search
MNTMRAIQVVGYHEGLKMTEAPIPEVAGAWDVVVRIGGAGVCRTDLHILEGQWAEKSQVQ
LPYTIGHENAGWVHAVGSAVANVKEGDKVILHPLITCGLCRACRSGDDVHCENSRFPGID
THGGYAEYLLTSARSVVKIDDSLEPADVAALADAGLTAYHAAAKAAKRLTPRDNCVVIGA
GGLGHIGIQVLKALTPSRIIVVDRNPAALELAKSIGADEGVLADGTQVEQVRALTGGNGA
EVLIDFVGEGGATSEGIAMLREAGDYFVVGYGEDISVPTIDIISSEINIIGNLVGSYNDL
QDLMSLAARGAVTLHTQKYKLDDFQQAISDLDAGKVRGRAILVP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatgcgagccatccaggtggttggctaccacgaaggcctgaaaatgaccgag
gcgcccattccggaagtggccggggcctgggacgtcgtggtccggatcggcggagccggt
gtgtgccggacggacctgcacatcctcgagggccagtgggccgaaaagtcccaggtgcag
ctgccctacaccatcggccacgagaacgcggggtgggtgcacgccgtcggcagcgcagtc
gccaacgtcaaggaaggcgacaaggtgatcctgcacccgctcatcacctgcggcctgtgc
cgcgcctgccgctcaggcgacgacgtgcactgcgagaacagcaggttccccggcatcgac
acccacggcgggtacgccgagtacctcctcacctccgcccggtccgtggtgaagatcgac
gattcactggaaccggcggacgtggcggccctggcggacgccggcctaacggcctaccac
gccgcggcgaaagcggccaagcggctgacgccgcgggacaactgcgtggtgatcggcgcc
ggcgggctgggccacatcgggatccaggtgctgaaggccctcacgccgagccggatcatt
gtggtggaccgcaacccggccgcccttgaactggcgaagtcgatcggagccgatgaaggg
gtcctcgcggacggcacgcaggtggaacaggtgcgcgccctcaccggcggcaacggcgcc
gaggtgctgatcgacttcgtgggtgaaggcggcgcgacgtccgagggcattgcaatgctg
cgggaggccggcgactacttcgtggtgggctacggcgaggacatcagcgtgccgaccatc
gacatcatctcctccgaaatcaacatcatcggcaacctcgtgggttcctacaacgacttg
caggacctcatgtcgctcgctgcccgcggggctgtcacgctgcacacccagaagtacaag
ctggatgatttccagcaggccatcagcgacctggacgccggcaaggtccgtggccgcgcc
atcctggtgccctga

DBGET integrated database retrieval system