KEGG   Arthrobacter phenanthrenivorans: Asphe3_11620Help
Entry
Asphe3_11620      CDS       T01435                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_11620
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asphe3_11620
   00650 Butanoate metabolism
    Asphe3_11620
  Energy metabolism
   00190 Oxidative phosphorylation
    Asphe3_11620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1223856..1224317)
Genome map
AA seq 153 aa AA seqDB search
MSATIESPRSGRIAPQYQRHGGSRGNFEMVAWLFMRLSGVVLVVLIFGHLFVNLLVGEGI
KAIDFGFVAGKWADPFWQFWDLTMLWLAMLHGTNGVRTIINDYAEKDSTRRWLKTVLYSA
TVVIIVLGTLVIFTFDPCPVVDGVPLPGGFCPA
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaacaatcgagagcccccgcagcgggcggatcgctccccagtaccagcgccac
ggggggagccgcggcaacttcgaaatggtcgcctggctcttcatgcggctatccggtgtg
gtcctggtggtcctcatcttcgggcacctcttcgtgaacctcctggtgggagaaggcatc
aaggccatcgacttcggttttgtggccggcaagtgggctgatccgttctggcagttctgg
gacctcaccatgctgtggctggccatgctgcacggcaccaacggtgtccgcaccatcatc
aacgactacgccgaaaaggactcaacccgccgctggctgaagacggtcctttactcggcc
accgtcgtcatcatcgtcctgggcaccctggtcatcttcaccttcgacccctgccccgtg
gttgacggtgttcccctgccgggcggattctgccctgcctag

DBGET integrated database retrieval system