KEGG   Arthrobacter phenanthrenivorans: Asphe3_12410Help
Entry
Asphe3_12410      CDS       T01435                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Asphe3_12410
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Asphe3_12410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1310198..1311160
Genome map
AA seq 320 aa AA seqDB search
MNAPAGRFAARTVRVKAPGKVNVSLEVGPLRPDGYHSVASVYLAVSLYEEVAATSTDTPG
ITVSLSPESTVDLDAADIPLDGSNLAYKAAAIMADVSERSTGVHLEITKRVPVAGGMGGG
SADAAATLLACDALWNSGLSREELAHLAGELGADVPFSLLGGAAVGLGVGDELSPALAKA
QTYWVLVTADYGLPTPEVYRTLDRLREAGGVQAAEPVGVDPQILTALRSGDAEALSRVLV
NDLQRASIELAPALRDTLGIGESHGAIAGIVSGSGPTVALLADDPVAAESLAEDLRHYGL
TALSVHGPVPGARIISDTLL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgccggcaggacgttttgctgccaggactgtccgcgtcaaggccccgggcaaa
gtcaatgtgtcactggaagtggggccgctccgtccggacggctaccactcggtggccagc
gtctaccttgctgtgtccttgtacgaggaagttgcggccaccagcaccgacaccccgggc
atcaccgtcagcctgagtccggagagcacagttgaccttgacgctgccgacatccccctg
gacggaagcaaccttgcctataaggctgcggcgatcatggcggacgtctccgaacgctcc
acgggcgtccacttggaaatcaccaagcgcgtgccggttgccggcggcatgggcggcggt
tcggcagacgccgccgccaccttgctggcatgtgatgcgctgtggaacagcggcctctcg
cgggaagaactggcacaccttgcaggcgaactaggcgccgacgttccgttttccctgctg
ggaggcgcggcggtgggactgggcgtcggcgacgaactctctccggcgctggcgaaagca
cagacctactgggtcctggtcacggccgattacggtcttcccactcccgaggtgtaccgg
acccttgaccgcctgcgggaggccggcggcgtccaggccgctgaacccgtcggcgtggat
ccgcagatcctcacggccctgcgcagcggagacgcggaagccctcagccgcgtcctggtc
aacgacctccaacgggcatccatcgagctggcgcctgcgctgcgcgatacgctgggaatc
ggagagtcccatggggccattgcagggatagtgtccggatcggggccaacagtggccctg
ctcgccgatgaccctgtggcggccgagagcctcgcagaggatctgcggcattacggcctg
accgcactctccgtccacggaccggttcccggggcgcgcatcatttccgacaccctcctc
taa

DBGET integrated database retrieval system