KEGG   Arthrobacter phenanthrenivorans: Asphe3_15300Help
Entry
Asphe3_15300      CDS       T01435                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_15300
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_15300
   00052 Galactose metabolism
    Asphe3_15300
   00500 Starch and sucrose metabolism
    Asphe3_15300
   00520 Amino sugar and nucleotide sugar metabolism
    Asphe3_15300
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Asphe3_15300
   00524 Butirosin and neomycin biosynthesis
    Asphe3_15300
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Asphe3_15300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634222..1635232
Genome map
AA seq 336 aa AA seqDB search
MGPRRGEGFRQHLRLGRKGLAIGIDIGGTKVAAGVVDADGRILSEARRTTPGRDPRAVEQ
VIVELVEELGRGHRIWSVGIGAAGWMDLDGGTVLFSPHLAWRNEPLRANLQQLLRRPVLL
ANDADAAAWAEWRFGAGQGEDRLVCITLGTGIGGAMVMDGRVERGRFGVAGEFGHQIIMP
GGHRCECGNRGCWEQYASGNALGREARILARANSPVAQDLLAAVGGRADAITGAIVTELA
LAGDPASRELLEEVGEWLGLGLANLAAALDPGLFVIGGGLCSAGDLLVEPARKAFARNLT
GRGFRPAAGIELAALGPNAGLIGAADLSRVSSRTRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccgcggcgcggcgagggcttccggcaacacctgcgccttgggcgtaaggggctg
gccattggcatcgacatcgggggcaccaaggtagccgcgggtgtggtggatgccgatggc
aggatcctcagcgaggcgcggcgaaccacgccgggcagggatccccgggccgtggagcag
gtcatcgttgagctggtggaggaactgggcaggggccaccggatctggtccgtagggatt
ggcgcggccggctggatggatctcgacggcggcacagtgctgttcagcccacacctcgcc
tggcgtaatgaaccgctccgggccaacctgcagcaactcctccgccggccggtgctcctg
gccaacgacgctgacgccgccgcctgggccgagtggcgctttggcgcgggccagggcgaa
gaccgcttggtttgtatcacgttgggtaccggtattggcggagccatggtgatggacggc
agggtagaacggggccgcttcggcgtggccggcgagttcgggcaccagatcatcatgccc
ggcgggcaccgctgtgaatgcggcaaccggggctgctgggagcagtacgcatctgggaat
gctttgggccgcgaggcaaggatcctggcgcgggccaactctccggtggcgcaggacctg
cttgcggccgtgggcggacgggcggacgccatcaccggtgccattgtgacggaactggcg
cttgccggcgatccggcttcacgcgaactgctcgaggaagtgggggagtggctgggcctt
ggcctggcaaatcttgccgccgcgctggatccggggctattcgttattggcggcgggttg
tgctcagccggtgacctgttggtggagcctgccaggaaggccttcgcacgcaacctgaca
ggccgcgggttccgtcccgcagcggggattgaactggccgcgctcgggcccaatgcgggg
cttatcggcgccgcagacctctccagggtaagcagccggacgcgtcgctga

DBGET integrated database retrieval system