KEGG   Arthrobacter phenanthrenivorans: Asphe3_15470Help
Entry
Asphe3_15470      CDS       T01435                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Asphe3_15470
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Asphe3_15470
Enzymes [BR:apn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Asphe3_15470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1652386..1654038
Genome map
AA seq 550 aa AA seqDB search
MSEFNPSDHSPAPEEPGPQGQGSQARFRPSAVEAVRLDSIGEAIGVVVPGASADVAVTGI
SLNSRTVERGDLYVALPGAVRHGADFAAQAIEAGAAAILTDDAGARLLALSSDTAVPVLV
VGAPRNVVGPLSAMIYRSNSTEGTPLQMFGVTGTNGKTTTTYFITSLLRSLGKKTGLIGT
IEILAGGSPVPSLLTTPESPDVHGLLALMRENGLTAAAMEVSSHAISYQRVDGVTFDVAG
FTNLTQDHLDLHHTMEDYFATKAELFTPARARKAVVTVDDEWGRRLAGAAAVPVITLSTS
AQHPGDWTVTETAARGLGTEFTLRGPGGTRLRVHTGLPGTFNVANAALAAVMVLAGGVDA
ATLQAALDAEDPFTVAVPGRMQLVSEQPAAVVDFAHNTDALARALEAVRSPEPGSRLIVV
FGATGQRDQGKRPAMGAIAARLADTVIVTDDDPHDEDAAAIRADVLAGAREAKARDSLPC
ILEEVFPRDKAIQRAVELARPEDTILVAGRGHEVWQEVKGVNLALDDRVELRSALTARGF
NVLQDDRIES
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
ttgtcagagttcaacccgtccgaccacagccccgccccggaggaaccaggcccgcaaggc
cagggcagccaggcccgcttccgcccgtcggctgtggaggctgtccggctggacagcatt
ggcgaggccatcggcgtcgttgttcccggtgcgtccgctgacgtggccgtgaccggtatt
tcgttgaactcccgcaccgtggagcgcggagacctgtacgtcgcccttcccggcgccgtc
cggcacggggccgacttcgctgcccaggccattgaagcgggggcggcggccatactgacg
gacgacgccggagcccggctcctggccttgtcctccgatacggcggtgcccgtcctggtg
gttggggcgccgcgcaacgtggtggggccgctgtctgccatgatctaccgcagcaacagc
acggagggcacgccgctgcagatgttcggggtgacaggcaccaacggcaagaccaccacc
acctacttcattacctcgctgctgcggtccctgggtaaaaagaccggcctgattggaacc
attgaaatccttgccggcgggagtcccgtgcccagcctgctcaccacgccggagtccccg
gacgtgcacggcctgctggcactgatgcgcgagaacggcctgacggcggcagcgatggaa
gtgtcctcccatgccatttcctaccagcgggtggacggcgtgacgttcgatgtcgccggc
ttcacgaacctcacgcaggaccacctggacctgcaccacaccatggaggactacttcgcc
accaaggcggagcttttcacgcccgcacgtgcgcggaaagccgtagtgactgtcgacgac
gagtggggccgccgcctggcaggcgccgccgccgtaccggtcatcaccctcagcacctcc
gcgcagcaccccggggactggacagtcacggaaacggcggcccgtggcctcggcacggaa
ttcacgctccgcgggccgggaggcaccaggctgcgggtccatacgggactgcctgggacc
ttcaacgtggccaatgcagcactggccgctgtcatggtgctggcaggcggcgtggacgct
gccaccctccaggccgcactggatgcggaagaccccttcaccgtggcagttccggggcgg
atgcagctggtgtccgaacagcccgcagcggtggtggactttgcccataacaccgacgca
cttgcccgggcgctggaagctgtccgttccccggaacccgggtcgcggctgatcgtggtg
ttcggcgccacagggcagcgcgaccagggcaagcgccccgccatgggcgccatagctgcc
cggctcgcagacaccgtcatcgtcaccgacgacgatccgcacgacgaggatgctgccgcc
atccgcgccgacgttctcgccggggcgcgggaagccaaggcaagggattccctgccctgc
atcctggaggaggtcttcccccgggataaggccatccagcgcgccgtggaactggcccgc
cccgaggacaccatcctggtggcggggcgcggccacgaggtgtggcaggaagtaaaaggt
gtcaacctcgccctggacgacagggtggagctgcgcagcgccttgacagccaggggattc
aacgttctccaagacgaccggatagagtcctag

DBGET integrated database retrieval system