KEGG   Arthrobacter phenanthrenivorans: Asphe3_15870Help
Entry
Asphe3_15870      CDS       T01435                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_15870
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asphe3_15870
  Amino acid metabolism
   00310 Lysine degradation
    Asphe3_15870
Enzymes [BR:apn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Asphe3_15870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1698157..1699920)
Genome map
AA seq 587 aa AA seqDB search
MSESVNLPALGESVTEGTVTRWLKQVGDRVEVDEPLLEVSTDKVDTEIPSPVAGVIEEIL
VAEDETAEVGAPLVRIGDGSGGGAPAEEAPAQQAPAEEAPAEEAPAQEAPAEEAPAQEAP
AQQAPAAGGAGGGESHEVTLPALGESVTEGTVTRWLKAVGDTVEMDEPLLEVSTDKVDTE
IPSPVAGTLQEIRVNEDETAEVGSVLAVIGSGAAAAPAEAPSTEAPVQEAPKAEEAPKAE
APAPQAAPAPAAAPAPAPEAPKEAPAPAAAEAPAAGGSESGYVTPLVRKLANQHGVDISS
LSGTGVGGRIRKQDVMAAAEAKAAPAPAPAAAPAAPAPAASSAAASSLRGTTQKAPRIRQ
VIARRMRESLEVSTQLTQVHEVDMTKVAKLRARAKNSFQAQNGTKLTFLPFIAKAVAEAL
KQHPKLNAAYDEDKQEITYHNAEHLAIAVDTDKGLLVPVINDAGSLNLAGLAGKIADVAS
RTRDGKIGPDELSGGTFSITNIGSVGALFDTPIINQPQVGILGTGAIVKRAVVVADENGD
DSIAIRSMMYLSLTYDHRLVDGADAGRFLQTLKARLEEGAFEADLGL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatccgttaacttgcccgccctcggtgagagcgtcaccgaaggaaccgtcacc
cgctggctcaagcaggtaggtgaccgggtagaggtggacgagcccctgctcgaagtctcc
accgacaaagtagacactgaaatcccctctcctgtagctggcgtgattgaggaaatcctg
gttgccgaggacgagaccgccgaggttggcgctcccctggtccgcataggcgacggctcc
ggcggcggtgcgcctgccgaagaagcccccgcacagcaggcacctgccgaggaagcaccc
gctgaagaagcacccgcccaggaagcaccggctgaagaagcacccgcacaggaagcgccc
gcacagcaggcacctgcggcgggcggcgccggcggcggcgaaagccacgaggtcaccctc
cccgcgctgggcgaaagcgtcaccgaaggtactgtcacccgctggctgaaagccgtgggc
gacaccgtggaaatggatgagcccctgctggaggtctccaccgacaaggtcgacaccgaa
attccgtcccccgtggccggtaccctgcaggaaatccgcgtcaacgaggacgagaccgca
gaggtcggctccgtcctggccgtcatcggttcaggcgcagctgccgctcccgcagaggct
ccctccaccgaggcgccggtgcaggaagcacccaaggctgaagaagcacccaaagccgag
gcgccggccccgcaggccgctcccgcaccggcagcagcccccgccccggcaccggaagca
cccaaagaagcacccgctcccgcagcagctgaggcccctgcagcaggcggctccgaatcc
ggctacgtgactcccctggtccgcaagctcgccaaccagcacggcgtggacatctcctcc
ctgtcaggcaccggcgtcggcggccgcatccgcaagcaggatgtcatggccgcagctgaa
gccaaggccgcacctgcaccggctccggccgctgcccctgctgccccggctcccgctgct
tccagcgccgctgcttcctcacttcgcggcaccacccagaaggccccgcgcatccgccag
gtcatcgcccgccgcatgcgcgaatccctcgaggtttccacgcagctgacgcaggtccac
gaggtggacatgaccaaggtggcgaagctccgtgcccgcgccaagaactccttccaggcg
cagaacggcaccaagctgacgttcctgccgttcatcgccaaggccgtggccgaggccctc
aagcagcaccccaagctcaacgctgcctacgacgaggacaagcaggagatcacctaccac
aacgccgagcacctggcgatcgccgtcgacactgataagggcctcctggttccggtcatc
aacgatgccggaagcctgaacctcgccggcctggcaggaaagatcgccgacgtcgccagc
cgtacgcgcgacggcaagattggtcctgacgagctgtccggcggtactttcagcatcacc
aacatcggctcggtgggggcactgttcgacaccccgatcatcaaccagccgcaggtgggc
atcctgggcaccggcgcgatcgtcaagcgtgccgtggtggttgccgacgagaacggcgac
gactcaatcgccatccgctccatgatgtacctgtccctgacgtacgaccaccgcctggtg
gacggcgcggacgcaggccgtttcctccagaccctgaaggcacgccttgaagaaggcgcg
ttcgaagcagacctggggctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system