KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_16680Help
Entry
Asphe3_16680      CDS       T01435                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asphe3_16680
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_16680
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asphe3_16680
Enzymes [BR:apn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Asphe3_16680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1781989..1783317
Genome map
AA seq 442 aa AA seqDB search
MAEAPSGNADNNAAEAFLQGGSLKHAPGPYFGSYGGRWMPESLIAALDELEETFNKAKDD
PEFRAQIADLNKNYSGRPSLLTEAKRFSQHAGGVRIFLKREDLNHTGSHKINNVLGQALL
AKRMGKTRVIAETGAGQHGVASATAAALMGLECVVYMGAEDCRRQALNVARMELLGATVI
PVTSGSQTLKDAINDALRDWVANVDNTHYLLGTAAGAHPFPAMVRYFHEVIGEEARAQIL
EQEGRLPDAVCACIGGGSNAIGIFHGFLDDPSVKIYGFEAGGDGVDTGRHAATITLGKPG
VLHGARSYLMQDDDGQTIESHSISAGLDYPGVGPEHSYLADIGRVSYEPITDSEAMESFR
LLCRTEGIIPAIESSHALAGAIKVGQRMAAEAAEAGGSAQDKIIIVNLSGRGDKDVATAA
EWFNLLDKDSAESEIGKEGEQL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagcaccctcaggaaacgctgacaacaatgccgctgaagcattcctgcagggc
ggctccctcaagcacgccccggggccgtacttcggcagctacggcggacgctggatgccc
gaatccctgattgccgccctggacgagctggaggagaccttcaacaaggccaaggatgat
cccgagttccgggcccagattgcggacctgaacaagaactactcaggcaggccttcattg
ctgactgaagccaagcgcttctcgcagcacgccgggggagtccggatcttcctcaagcgc
gaggacctcaaccacacggggtcgcacaagatcaacaacgtcctgggccaggcgctgctt
gccaagcgcatgggcaagacccgcgtcatcgccgagaccggtgccggccagcacggcgtt
gccagcgccaccgcagccgctctgatgggcctggaatgcgtggtgtacatgggggccgag
gactgccgccggcaggcgctcaacgttgcccggatggaactgctgggcgccaccgtcatc
ccggtcaccagcggctcgcagaccctcaaggacgccatcaacgacgccctgcgcgactgg
gtggccaacgtggacaacacccactacctcctgggcacggcagcaggagcccacccgttc
cccgccatggtccggtacttccatgaggtcatcggcgaggaagcccgcgcccagatcctg
gagcaggaaggccgcctcccggatgctgtctgcgcctgcatcggcggcggctccaacgcc
atcggcatcttccacggcttccttgatgacccgtcggtgaagatctacgggttcgaagcc
ggcggcgacggcgtagacacgggacgccatgccgccaccatcaccctcggcaagccgggc
gtcctgcatggtgcccgctcctacctcatgcaggatgacgacggccagaccatcgagtcc
cactcgatctcggccggcctggactaccccggcgtggggccggagcactcctacttggcc
gatatcggccgggtgagctacgagcccatcacggacagcgaggccatggagtccttccgc
ctgctgtgccgcaccgagggaatcattcccgccattgagtcctcgcacgccctggccggc
gcgatcaaggtgggccagcgcatggccgccgaagccgctgaggccggcggttcagcccag
gacaagatcatcatcgtgaatctttccgggcgcggtgacaaggacgttgccaccgcagcc
gaatggttcaacctgttggacaaggattccgctgagtcggaaatcggcaaagagggggag
cagctgtga

DBGET integrated database retrieval system