KEGG   Arthrobacter phenanthrenivorans: Asphe3_16690Help
Entry
Asphe3_16690      CDS       T01435                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asphe3_16690
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_16690
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Asphe3_16690
Enzymes [BR:apn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Asphe3_16690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1783314..1784123
Genome map
AA seq 269 aa AA seqDB search
MTTAQTTSKSAAAIDKARAEGRAALIGYLPAGYPSVEDTIAAGIALAENGADLIEIGIPY
SDPVMDGQVIQAATTEALAKGFSVSQVFDVVRGITSKTDAAVLVMTYWNPVVRMGVDEFS
RRLSEAGGAGLITPDLIPDEAAEWMEASDKYGLDRVFLVAPSSTPERMQRTVDASRGFVY
AVSIMGVTGARTSVSTAAKDVVAAAHAAGAERVCVGLGVSNADQVREIAAYAEGVIVGTA
LVAAIRDGGVEAVAALTKDLSTGLAKEEA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgaccactgcacagaccaccagcaaatcggcggcagccatcgacaaggcccgcgccgaa
ggccgtgccgccctgatcggctaccttcccgcgggataccccagcgtggaggacaccatc
gccgcgggcatcgcactggctgagaacggcgccgacctgatcgagatcggcattccctac
tcggaccccgtgatggacgggcaggtcatccaggccgccaccaccgaggcgctggccaag
ggcttctccgtcagccaggtgttcgacgtggtccgcggcatcaccagcaagaccgacgcc
gccgtgctggtgatgacctactggaaccccgtggtccggatgggtgtggacgagttctcc
cgccgcctgtccgaagccgggggagcagggctcatcacccctgacctcatccccgacgag
gcagccgagtggatggaagcctccgacaaatacgggcttgaccgggtgttcctggtggcg
ccgtcctccacgcccgaacgcatgcagcgcaccgtggatgcgagccgcggctttgtctac
gccgtatccatcatgggcgtcaccggtgcgcggacctccgtcagcaccgcggccaaggac
gtggtggccgccgctcacgcggccggcgccgagcgcgtctgcgtggggttgggcgtttcc
aacgccgaccaggtccgcgaaatcgcagcgtacgccgaaggcgtgatcgttggcaccgcc
ctggtggcggccatccgcgacggcggcgtggaagcagtcgcagcccttaccaaggacctc
agcaccggcctggccaaggaagaagcgtag

DBGET integrated database retrieval system