KEGG   Arthrobacter phenanthrenivorans: Asphe3_18080Help
Entry
Asphe3_18080      CDS       T01435                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_18080
   01230 Biosynthesis of amino acids
    Asphe3_18080
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_18080
   00051 Fructose and mannose metabolism
    Asphe3_18080
   00562 Inositol phosphate metabolism
    Asphe3_18080
Enzymes [BR:apn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Asphe3_18080
Exosome [BR:apn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Asphe3_18080
  Exosomal proteins of bladder cancer cells
   Asphe3_18080
  Exosomal proteins of melanoma cells
   Asphe3_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1949780..1950595
Genome map
AA seq 271 aa AA seqDB search
MTTSTNGAFDRKPFIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYSRVEVAVFPPFTDL
RGVQTLVQGDNLDIAYGGQDLSPNDSGAFTGDISGQFLNKLGCKYVLVGHSERRTIHNES
DELLNAKVKAAFKHGLVPVLCVGEGLEIRQAGTHVNHTLEQLRAGVAGLTPEQAAELVVA
YEPVWAIGTGEVAGPGDAQEMCAAIRAELESLFGAETAAKTRLLYGGSVKANNAAAILKE
RDVDGLLVGGASLDPAEFANIVRFESHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgactacgtcaacgaacggcgctttcgaccgcaagcccttcatagcgggcaactggaaa
atgaacatggaccacgtgcagggcattaccctcctgcagaagctcgcctggaccctttcg
gatgccaagcacgactacagccgggtggaagttgccgtcttcccgccgttcactgacctc
cgcggcgtgcagaccctggtccagggtgacaatctggacatcgcgtacggcggacaggat
ctttctccgaatgattccggtgccttcaccggtgatatctccggccagttcctcaacaag
ctgggctgcaagtacgtcctggtgggacacagcgaacgccgcaccatccacaacgaatcc
gacgagctcctcaacgccaaggtcaaggccgccttcaagcacggactggttcccgtgctc
tgcgtgggtgaaggcctcgaaatccgccaggccggcacccatgtaaaccacacactggaa
cagctgcgtgccggagttgccgggctcacccctgagcaggcagcggaacttgtggtcgcc
tacgagcctgtctgggccatcggcaccggcgaagtggcagggcccggggacgcccaggaa
atgtgtgccgcgatccgagccgaactcgaatcactgttcggcgcggaaaccgccgccaag
acccggctgctgtatggtggatcggtcaaggccaacaacgccgccgccatcttgaaggaa
cgcgacgtggacggcctgctggtgggcggtgcgagcctcgatccggccgagtttgctaat
attgtcaggttcgagagtcacctggtgacggactag

DBGET integrated database retrieval system