KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_18080Help
Entry
Asphe3_18080      CDS       T01435                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00010  Glycolysis / Gluconeogenesis
apn00051  Fructose and mannose metabolism
apn00562  Inositol phosphate metabolism
apn01100  Metabolic pathways
apn01110  Biosynthesis of secondary metabolites
apn01120  Microbial metabolism in diverse environments
apn01130  Biosynthesis of antibiotics
apn01200  Carbon metabolism
apn01230  Biosynthesis of amino acids
Module
apn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
apn_M00002  Glycolysis, core module involving three-carbon compounds
apn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_18080
   00051 Fructose and mannose metabolism
    Asphe3_18080
   00562 Inositol phosphate metabolism
    Asphe3_18080
Enzymes [BR:apn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Asphe3_18080
Exosome [BR:apn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Asphe3_18080
  Exosomal proteins of bladder cancer cells
   Asphe3_18080
  Exosomal proteins of melanoma cells
   Asphe3_18080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADX72964
UniProt: F0MBN1
Position
1949780..1950595
Genome map
AA seq 271 aa AA seqDB search
MTTSTNGAFDRKPFIAGNWKMNMDHVQGITLLQKLAWTLSDAKHDYSRVEVAVFPPFTDL
RGVQTLVQGDNLDIAYGGQDLSPNDSGAFTGDISGQFLNKLGCKYVLVGHSERRTIHNES
DELLNAKVKAAFKHGLVPVLCVGEGLEIRQAGTHVNHTLEQLRAGVAGLTPEQAAELVVA
YEPVWAIGTGEVAGPGDAQEMCAAIRAELESLFGAETAAKTRLLYGGSVKANNAAAILKE
RDVDGLLVGGASLDPAEFANIVRFESHLVTD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgactacgtcaacgaacggcgctttcgaccgcaagcccttcatagcgggcaactggaaa
atgaacatggaccacgtgcagggcattaccctcctgcagaagctcgcctggaccctttcg
gatgccaagcacgactacagccgggtggaagttgccgtcttcccgccgttcactgacctc
cgcggcgtgcagaccctggtccagggtgacaatctggacatcgcgtacggcggacaggat
ctttctccgaatgattccggtgccttcaccggtgatatctccggccagttcctcaacaag
ctgggctgcaagtacgtcctggtgggacacagcgaacgccgcaccatccacaacgaatcc
gacgagctcctcaacgccaaggtcaaggccgccttcaagcacggactggttcccgtgctc
tgcgtgggtgaaggcctcgaaatccgccaggccggcacccatgtaaaccacacactggaa
cagctgcgtgccggagttgccgggctcacccctgagcaggcagcggaacttgtggtcgcc
tacgagcctgtctgggccatcggcaccggcgaagtggcagggcccggggacgcccaggaa
atgtgtgccgcgatccgagccgaactcgaatcactgttcggcgcggaaaccgccgccaag
acccggctgctgtatggtggatcggtcaaggccaacaacgccgccgccatcttgaaggaa
cgcgacgtggacggcctgctggtgggcggtgcgagcctcgatccggccgagtttgctaat
attgtcaggttcgagagtcacctggtgacggactag

DBGET integrated database retrieval system