KEGG   Arthrobacter phenanthrenivorans: Asphe3_19780Help
Entry
Asphe3_19780      CDS       T01435                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:apn00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2125536..2127050)
Genome map
AA seq 504 aa AA seqDB search
MNQYVIAIDQGTTSTRAIIFDHSGSIVSSGQMEHEQIFPQAGWVEHNAAEIWNNTREVIA
SALSKANLTRHDIAAVGITNQRETAVVWDKTTGEAIYNAIVWQDTRTQDIVDELARDGGP
DRFKQKVGLPLATYFSGTKIKWILDNVEGAREKAEAGDLVFGNTDAWVLWNLTGGVDGGV
HVTDVTNASRTLFMDLETLQWDDEILGIFGVPRSMMPEIKSSSEVYGTVHSSQLLRETPV
AGILGDQQAATFGQAAFDTGEAKNTYGTGCFLIFNTGEEIVHSKNGLLTTVGYKLGDAAP
HYALEGSIAVTGSLIQWLRDNLGLINSAPEVETLAASVKDNGGVYIVPAFSGLFAPYWRS
DARGAIVGLTRFVNKNHIARAALEATAFQTREVLDAVNADSGVPLSELKVDGGMVANDAL
MQFQADILGVPVIRPKVVETTALGAAYAAGLAVGFWKDLGECSANWSEDKRWEPQMDQAE
QDRQMRLWKKAVTKSMDWVDEDVR
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtacgtaatcgccatcgaccagggaaccaccagcacccgggccatcatcttt
gaccacagcgggagcatcgtgtcctcagggcagatggagcacgaacagatcttcccgcag
gccggctgggtagagcacaacgctgcggagatttggaacaacacccgtgaggtcattgcc
tccgccctgtccaaggcgaacctgacacggcacgatattgccgccgtcggaatcaccaac
cagcgcgaaaccgcggtggtgtgggacaagaccacaggtgaagcaatctacaacgccatc
gtctggcaggacacccggacccaggacatcgtggacgagctggccagggacggagggccg
gaccggttcaagcaaaaagtgggactgccgctggcaacctatttctcgggtaccaagatc
aagtggatcctggacaacgtggaaggtgcccgcgaaaaggcagaagccggggacctggtc
tttggcaacaccgatgcctgggtgctgtggaacctgaccggcggtgtggacggcggtgtc
cacgtcactgacgttaccaacgcctcccggactctgttcatggacctcgaaacgctgcag
tgggacgacgaaatcctcggtatcttcggcgtaccccgcagcatgatgccggagatcaag
tcctcttcagaggtgtacggcacggtccacagctcgcagctgctccgcgagactcccgtg
gcggggatcctgggtgaccagcaggccgccacattcgggcaggctgccttcgacaccggc
gaagccaaaaatacctacggcaccggctgcttcctgatcttcaacaccggcgaagagatc
gtccactccaagaacgggctgctgaccaccgtgggctacaagctcggggacgcagcgccg
cactacgctctggaaggttccattgccgtcaccggttcgctcatccagtggctgcgggac
aacctgggcctgatcaacagcgcccccgaggtggaaaccctggcagcgtcggtgaaggac
aacggcggtgtctacatcgtcccggctttctccggcctctttgctccctactggcgctcg
gatgcccgcggcgccatcgtgggcctcacccgtttcgtcaacaagaaccacatcgcgcgg
gccgccctggaagctacggccttccagacccgcgaggtgctggacgccgtcaacgcggat
tccggcgtgccgctgtccgaactgaaggtcgacggcggcatggtcgccaacgatgcactg
atgcaattccaggcggacatcctgggcgttcccgtgatccgccccaaggtggtggagacc
accgccctcggcgcggcctacgcggccggccttgcggtcgggttctggaaggacctgggc
gagtgctccgccaactggtccgaggacaagcgctgggaaccgcagatggaccaggccgaa
caggaccgccagatgcgcctttggaagaaggccgtcaccaagtccatggactgggtggac
gaggacgtgcggtaa

DBGET integrated database retrieval system