KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_19890Help
Entry
Asphe3_19890      CDS       T01435                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00230  Purine metabolism
apn01100  Metabolic pathways
Module
apn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Asphe3_19890
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Asphe3_19890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 TOBE_2
Motif
Other DBs
NCBI-ProteinID: ADX73144
UniProt: F0M1Z2
Position
complement(2138975..2139571)
Genome map
AA seq 198 aa AA seqDB search
MSNKPGLTVLAGPTAVGKGTVSTYIRDNYPEVWLSVSATTRAPRPGEQDGVHYFFKSKEE
FEKLIADGELLEWAVVHGQNTYGTLKSTVNQAIAEGRSVLLEIDLQGARQVKAAVPDAQF
VFLAPPSWDEMVRRLVGRGTETPEEQQRRLETAKLELAAEPEFDHTVINDDVRRAADELV
SLMGLTPHPHGTPEHSAR
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaataaaccgggactgacagtcctcgctggtccgacggctgttggcaaaggcacc
gtgtccacctacatccgggacaactatcccgaggtctggctgtccgtatccgccaccacc
cgcgctccgcgcccgggagagcaggacggcgtccactacttcttcaagtccaaggaggag
ttcgaaaagctcatcgccgacggtgaactcctggagtgggccgtggtccacggccagaac
acctacgggacgctgaaaagcaccgtgaaccaggccatcgcggaaggcaggtcggttctc
ctggagatcgacctgcagggcgcgcgccaggtcaaggctgccgttccggacgcccagttc
gtgtttctggccccgcccagctgggacgaaatggtccgccggcttgtgggccgcggcacg
gaaacccccgaggaacagcagcgacgcctggaaaccgctaaactggaacttgctgctgaa
ccggagttcgaccacaccgttatcaatgacgacgttcgccgggcagcggacgagcttgtt
tcactcatggggctgaccccgcatccgcacggaacgccggaacactcagcccgctag

DBGET integrated database retrieval system