KEGG   Arthrobacter phenanthrenivorans: Asphe3_22620Help
Entry
Asphe3_22620      CDS       T01435                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:apn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:apn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2402704..2403801)
Genome map
AA seq 365 aa AA seqDB search
MLANARRIVVKVGSSSLTSIKGGISEEALTALADALAAKRNSGTEIILVSSGAIAAGLAP
LGLAKRPRDLATQQAAASVGQGLLMARYTQAFGAHGVTVSQVLLTAEDLMRRSQHTNAFR
ALDRLLNLGVVPVVNENDTVATHEIRFGDNDRLAALVAHLVRADALVLLSDVDSLYDGPP
SLGAKRIPLVEGASDLEGVSIGKAGKAGVGTGGMLTKVEAATMAAGSGIHALVTSTPNAA
AALNGEDVGTWFTVNGARKPVRLLWLAHVASVQGRLVLDDGAVRAVRHHRTSLLPAGISA
VHGEFEAGDAVEIAAADGTVVARGLVNYSSSELPQMLGRSTRDLGEALGSGYDREVVHVD
DLVLV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgctggccaacgcgcgccggatcgtggtcaaggttggctcgtcgtcgctcaccagcatc
aagggcggcatctccgaagaagcgctcacggcccttgcggacgcgttggctgccaagcgc
aactcaggcactgaaatcatcctggtctcctccggggccatcgctgccggcctggcgccc
ctggggctcgccaagcgcccgcgtgacctcgccacccagcaggcagcggccagtgtgggc
caaggcctcctgatggcgcgctacacccaggcctttggggcccacggcgtgacggtcagc
caggtgctcctcacggctgaggacctgatgcggcggagccagcacaccaacgcgttccgc
gcactggaccggctgctcaacctcggcgtggtcccggtggtcaacgagaacgacaccgtc
gccacccacgagatcaggttcggcgacaacgaccgcctggccgcgctggtggcgcacctg
gtacgggctgatgcgctggtgctgctgtccgacgtcgactccctctacgatggcccgcca
tcccttggcgccaagcggattccgctggttgaaggcgcgtccgacctggaaggcgtgtcc
atcggcaaggccggcaaagcaggcgttggcacgggtggaatgctgacaaaggtcgaggca
gccacgatggctgcgggatccggcatccatgcccttgtcacctcgacacccaatgccgcc
gcagcgctgaacggcgaggatgtgggcacgtggttcaccgtcaacggtgcccgcaaaccg
gtccgcctgctgtggctggcgcatgtggcatccgtccagggccgcctggtcctcgatgac
ggtgccgtccgtgcggtacgccaccaccgcacgtcactcctcccggcgggcatctccgcc
gtccacggcgagttcgaagcgggcgacgccgtcgaaattgccgctgccgacggtacggtg
gtggcgcgtggactggtgaactactcgtccagcgagctgccccagatgctgggcaggtcc
acccgggacctgggcgaggcgctgggcagcggctacgaccgtgaagttgttcatgttgac
gacctggtgctggtctaa

DBGET integrated database retrieval system