KEGG   Arthrobacter phenanthrenivorans: Asphe3_23000Help
Entry
Asphe3_23000      CDS       T01435                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:apn00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:apn00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2445361..2446548
Genome map
AA seq 395 aa AA seqDB search
MTLSPTPADKFTFGLWTVGWTGADPFGVATRAALDPVEAVHRLAELGAYGITFHDNDLVP
FEATASERELILKNFKAALAETGLKVPMVTTNLFSHPVFKDGGFTSNDRSIRRFALSKVL
RNIDSAAEFGAETFVMWGGREGSEYDGSKDLAAALDRMKEGVDTAAAYIKDKGYNLRIAL
EPKPNEPRGDIFLPTVGHGLAFIAQLEHGDIVGLNPETGHEQMAGLNFTHGIAQALWAGK
LFHIDLNGQRGIKYDQDLVFGHGDLTSAFFTVDLLENGFPNGGPRYDGPRHFDYKPSRTD
GYDGVWESAKANMATYLLLKERALAFRADPEVQAALATSGVGELGEPTLAAGETTTDLLA
DTTAFEDFDANKAAERSFAFVRLNQLAIEHLLGAR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgactctctcccctacaccggctgataagttcacttttggtttgtggaccgttggctgg
accggtgctgacccgttcggtgtcgccacccgcgcggccctggatcctgttgaggcggtc
caccggctggccgagctgggtgcgtacggcatcacgttccatgacaacgacctggtcccg
ttcgaggccacggcctcggagcgggagctgatcctgaagaacttcaaggcagccctggcc
gagaccggcctgaaggttcccatggtgaccaccaacctgttcagccacccggtgttcaag
gacggcggcttcacctccaacgaccgttccatccgccggttcgccctgtccaaggtgctg
cgcaacatcgattcggccgccgagttcggtgctgagactttcgtgatgtggggcgggcgt
gaaggcagcgaatacgacgggtccaaggacctcgccgcggccctggaccggatgaaggaa
ggcgtggacaccgccgccgcctacatcaaggacaagggctacaacctgcgcatcgccctg
gagcccaagccgaacgagccgcgcggtgacatcttcctgcccaccgtgggccacggcctg
gcgttcatcgcccagctcgaacacggcgacatcgtgggcctgaaccccgaaaccgggcac
gagcagatggccgggctgaacttcacccacggcatcgcccaggccctgtgggccggcaag
ctcttccacatcgacctcaacggccagcgcggcatcaagtacgaccaggacctcgtcttc
ggccacggcgacctgaccagcgcgttcttcaccgtggacctgctcgaaaacggcttcccc
aacggcggcccccgctacgacggaccgcggcacttcgactacaagccctcccgcaccgac
ggctacgacggcgtctgggaatcagccaaagcaaacatggccacctacctgctcctgaaa
gaacgcgccctggccttccgcgcagaccccgaagtccaggcagccctggccacctccggc
gtcggcgaactcggcgaacccaccctcgccgccggcgaaaccaccaccgacctgctcgcc
gacaccaccgcgttcgaagacttcgacgccaacaaagcagccgaacgctccttcgccttc
gtccgcctcaaccaactcgccatcgaacacctcctgggtgcccgctaa

DBGET integrated database retrieval system