KEGG   Arthrobacter phenanthrenivorans: Asphe3_23930Help
Entry
Asphe3_23930      CDS       T01435                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Asphe3_23930
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Asphe3_23930
Enzymes [BR:apn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Asphe3_23930
Amino acid related enzymes [BR:apn01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Asphe3_23930
Transfer RNA biogenesis [BR:apn03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Asphe3_23930
 Prokaryotic Type
   Other AARSs
    Asphe3_23930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2536622..2538136)
Genome map
AA seq 504 aa AA seqDB search
MTTASASNAASLPSVSADTPVRVRFCPSPTGTPHVGLIRTALFNWAHARHTKGTFVFRIE
DTDAARDSEESYQQLLEALKWLGITWDEGVEVGGPHEPYRQSQRLDLYKDVVAKLIDAGY
AYECYSSPEEVEARHRAAGRDPKLGYDNFDRELTDEQVAAFKSEGRQPVLRVRMPDEDVT
FTDLVRGEITFKAGSIPDYVIVRADGSPLYTLVNPVDDALMGITHVLRGEDLLSSTPRQV
VLIRALMEIGVASYVPEFGHLPYVMGEGNKKLSKRDPQSNLFLLRDRGFIPEGLLNYLSL
LGWSLSADEDIFTVEQLIENFDVHDVLANPARFDIKKAEAINGTHIRMLGAGDFRERLVP
YLRSAGLVGEELTERQEEILTEAAPLIQERIALLGEAPDMLGFLFKDDDAIDVADDARKG
LPANLSEVLDAALAALEGVQAWTAEDIQAALKQALVEDLGLKPRLAFGPVRTAVSGRRIS
PPLFESMVILGRESSLSRIRAFRG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcttccgcgtcgaatgctgcctccctgccctctgtatctgccgacacgccc
gtccgggtgcggttctgcccttcgcccaccggtaccccgcacgtcgggctgatccggacg
gccctgttcaactgggcccatgccaggcacaccaagggcactttcgttttccgcatcgag
gacacagacgcggcacgtgattcggaggagagctaccagcagctgctggaggccttgaaa
tggctcggcatcacctgggatgaaggcgtggaggtgggcggtccccacgaaccctaccgg
cagtcgcagcggctggacctctacaaggacgtcgtggccaagctgatcgacgccggctac
gcctacgagtgctactcgtcccccgaggaggtcgaggcgcgccaccgcgcggctggccgc
gatccgaagctcggctacgacaacttcgaccgtgaattgaccgacgagcaggtggccgcc
ttcaagtccgaaggccggcagccggtgctccgggtccggatgcctgatgaagacgttacc
ttcaccgacctggtccgcggtgagatcaccttcaaggccggcagcattccggactatgtc
atcgtgcgcgcggatggctcaccgctgtacacgctggtaaaccccgtggacgacgccctc
atgggcattacccacgtgctgcgcggcgaggacctgctttcctccacgccgcgccaggtt
gtcctcatccgcgcactgatggagatcggcgtggccagctacgtgccggagttcggccac
ctgccgtacgtcatgggggaaggcaacaagaagctgtccaagcgtgatccgcagtccaac
ctgttcctcctgcgggaccgcggcttcattcccgaaggactcctgaactacctgtccctg
ctgggctggagcctttccgcggacgaggacatcttcacggtggagcagctcatcgaaaac
ttcgacgtccatgacgtcctggccaacccggcgcgcttcgacatcaagaaggccgaagcc
atcaacggcacgcatattcggatgctcggagccggggacttccgggagcggctggtcccg
tacctgcgctccgccgggctggtgggcgaggagctcacggagcggcaggaggaaatcctt
accgaggccgcaccgctgatccaggagcgcatcgccctgctgggggaggcgccggacatg
ctcggcttcctgttcaaggacgatgacgcgatcgacgtggcggacgacgcgcggaagggc
ctgccggcgaacctgtccgaggtgctggatgctgcccttgccgccctggaaggggtgcag
gcctggacggctgaagacatccaggccgcgctcaagcaggcactggtggaagacctgggc
ctcaagccccgcctggcgttcggtccggtccgcacggctgtttccggccgccgcatctca
ccgccgctgttcgaatccatggtgatccttggccgggaatcctccctcagcaggatcagg
gcgttccgcggctga

DBGET integrated database retrieval system