KEGG   Arthrobacter phenanthrenivorans: Asphe3_23930Help
Entry
Asphe3_23930      CDS       T01435                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K01885  
glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Porphyrin and chlorophyll metabolism
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:apn00860]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:apn00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2536622..2538136)
Genome map
AA seq 504 aa AA seqDB search
MTTASASNAASLPSVSADTPVRVRFCPSPTGTPHVGLIRTALFNWAHARHTKGTFVFRIE
DTDAARDSEESYQQLLEALKWLGITWDEGVEVGGPHEPYRQSQRLDLYKDVVAKLIDAGY
AYECYSSPEEVEARHRAAGRDPKLGYDNFDRELTDEQVAAFKSEGRQPVLRVRMPDEDVT
FTDLVRGEITFKAGSIPDYVIVRADGSPLYTLVNPVDDALMGITHVLRGEDLLSSTPRQV
VLIRALMEIGVASYVPEFGHLPYVMGEGNKKLSKRDPQSNLFLLRDRGFIPEGLLNYLSL
LGWSLSADEDIFTVEQLIENFDVHDVLANPARFDIKKAEAINGTHIRMLGAGDFRERLVP
YLRSAGLVGEELTERQEEILTEAAPLIQERIALLGEAPDMLGFLFKDDDAIDVADDARKG
LPANLSEVLDAALAALEGVQAWTAEDIQAALKQALVEDLGLKPRLAFGPVRTAVSGRRIS
PPLFESMVILGRESSLSRIRAFRG
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcttccgcgtcgaatgctgcctccctgccctctgtatctgccgacacgccc
gtccgggtgcggttctgcccttcgcccaccggtaccccgcacgtcgggctgatccggacg
gccctgttcaactgggcccatgccaggcacaccaagggcactttcgttttccgcatcgag
gacacagacgcggcacgtgattcggaggagagctaccagcagctgctggaggccttgaaa
tggctcggcatcacctgggatgaaggcgtggaggtgggcggtccccacgaaccctaccgg
cagtcgcagcggctggacctctacaaggacgtcgtggccaagctgatcgacgccggctac
gcctacgagtgctactcgtcccccgaggaggtcgaggcgcgccaccgcgcggctggccgc
gatccgaagctcggctacgacaacttcgaccgtgaattgaccgacgagcaggtggccgcc
ttcaagtccgaaggccggcagccggtgctccgggtccggatgcctgatgaagacgttacc
ttcaccgacctggtccgcggtgagatcaccttcaaggccggcagcattccggactatgtc
atcgtgcgcgcggatggctcaccgctgtacacgctggtaaaccccgtggacgacgccctc
atgggcattacccacgtgctgcgcggcgaggacctgctttcctccacgccgcgccaggtt
gtcctcatccgcgcactgatggagatcggcgtggccagctacgtgccggagttcggccac
ctgccgtacgtcatgggggaaggcaacaagaagctgtccaagcgtgatccgcagtccaac
ctgttcctcctgcgggaccgcggcttcattcccgaaggactcctgaactacctgtccctg
ctgggctggagcctttccgcggacgaggacatcttcacggtggagcagctcatcgaaaac
ttcgacgtccatgacgtcctggccaacccggcgcgcttcgacatcaagaaggccgaagcc
atcaacggcacgcatattcggatgctcggagccggggacttccgggagcggctggtcccg
tacctgcgctccgccgggctggtgggcgaggagctcacggagcggcaggaggaaatcctt
accgaggccgcaccgctgatccaggagcgcatcgccctgctgggggaggcgccggacatg
ctcggcttcctgttcaaggacgatgacgcgatcgacgtggcggacgacgcgcggaagggc
ctgccggcgaacctgtccgaggtgctggatgctgcccttgccgccctggaaggggtgcag
gcctggacggctgaagacatccaggccgcgctcaagcaggcactggtggaagacctgggc
ctcaagccccgcctggcgttcggtccggtccgcacggctgtttccggccgccgcatctca
ccgccgctgttcgaatccatggtgatccttggccgggaatcctccctcagcaggatcagg
gcgttccgcggctga

DBGET integrated database retrieval system