KEGG   Arthrobacter phenanthrenivorans: Asphe3_24490Help
Entry
Asphe3_24490      CDS       T01435                                 

Definition
(RefSeq) nicotinamidase-like amidase
  KO
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Asphe3_24490
Enzymes [BR:apn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Asphe3_24490
    3.5.1.-  
     Asphe3_24490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2601371..2602009
Genome map
AA seq 212 aa AA seqDB search
MSRALIIVDVQNDFCEGGSLAVSGGADVAGAISEYVEAHHGEFDHIVATQDWHIDPGGHF
SETPDFKDSWPPHCVAGTPGAELHPDLDTEYIQAYFQKGQYAAAYSGFEGLLAPEDAVPT
GERQPGALPGPGDAERFAPDDDAIGLDDWLQSHDVEDVVVVGIATDYCVMATALDAVQAG
YSVTVLRSLTAGIAEDLEEAVAEMELGGVDVA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgggcactgatcatcgtcgacgtccagaacgacttctgcgagggcggctcgctg
gccgtctccggcggcgcggacgtggccggcgccatcagcgagtatgtggaggcccatcac
ggcgagttcgaccacatcgtcgccacccaggactggcacatcgatccgggcgggcacttc
tccgaaaccccggacttcaaggacagctggccgccccattgcgtggcgggaaccccgggc
gccgaactgcaccccgacctggacaccgagtacatccaggcctacttccagaagggccag
tacgcggcggcctactcgggcttcgagggactcctggcgcctgaggacgccgtgcccacc
ggggaacggcagcccggtgccctgcccggtccaggggacgccgagaggttcgccccggac
gatgacgccatcgggctcgacgactggctccagagccatgacgtggaggatgttgtggtg
gtgggcatcgccaccgattactgcgttatggccacagcgctggacgccgtccaggcaggc
tactccgtcaccgtcctccgttccctgaccgccgggatcgccgaggacctcgaagaagcg
gttgccgagatggagctcggcggcgtggacgtcgcctga

DBGET integrated database retrieval system