KEGG   Arthrobacter phenanthrenivorans: Asphe3_24850Help
Entry
Asphe3_24850      CDS       T01435                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asphe3_24850
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_24850
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Asphe3_24850
Enzymes [BR:apn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Asphe3_24850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2637808..2638914)
Genome map
AA seq 368 aa AA seqDB search
MAHQWRGVIREYADRLPVTESTKVITLGEGGTPLVHARKLSELTGSEVYLKVEGMNPTGS
FKDRGMTMAMTAAVASGAQAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQ
AIAHGATLLQVDGNFDNCLDIARKLGESYPVFLVNSVNPARIQGQKTGAFEIVDALGDAP
DIHVLPVGNAGNITAYWKGYKEYSAPFESETAGTLAPVATRTPAMWGFQASGAAPFVAGH
PITEPDTIATAIRIGNPASWDGAIGARDESGGLIDAVTDEEILNAHRWLSSREGVFVEPG
SAAGVAGLLKKHAAGEVPAGKTIVITVTGHGLKDPQWALRTEDGSDVQPVKVPNDVVTVA
AELGLEEK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaccaatggcgcggcgtcatccgcgaatacgctgaccgtctgcccgtgacggaa
tccaccaaggtcatcaccctcggggagggcggcactccgctggtgcacgcccggaagctt
tccgagctcaccggttccgaggtctacctgaaggtggagggcatgaaccccaccggatcc
ttcaaggaccgcggcatgaccatggccatgacagctgccgtcgcttccggcgcccaggcc
gtcgtgtgcgcctccaccggcaacacctctgcttccgcagccgcgtatgccaccgcggcc
ggcctcaagtgcgcagtgctggtgcccgagggcaaaatctccatgggcaagctcagccag
gccatcgcccacggcgccacactgctgcaggtggacggcaacttcgacaactgcctggac
atcgcacggaagctgggggagtcctaccccgttttcctggtcaactccgtcaaccccgcc
cgtatccagggccaaaagaccggtgccttcgaaatcgtggacgcactgggtgacgccccg
gacatccacgtcctgccggtgggcaacgccggcaacatcaccgcctactggaagggctac
aaggagtactccgctcccttcgagtccgaaaccgccggcaccctggccccggtagccacc
aggactcctgccatgtggggcttccaggcatctggcgccgccccgttcgtggccggccac
cccatcacggaaccggacaccatcgccacggcgatccgcatcggcaaccccgcgtcatgg
gacggcgcgatcggtgcccgcgacgagtccggcgggctcatcgatgccgtgacggacgag
gaaatcctcaacgcccaccgctggctgtcttcgcgtgaaggtgtgtttgttgagcccgga
tcggcagccggcgtggccggtttgctgaagaagcacgctgcaggcgaggtcccggccggt
aagacgatcgtcatcacggtcacgggacacggactcaaggacccgcagtgggccttgcgc
accgaggacggcagcgatgtccagccggtcaaggttcccaatgatgtggtcactgttgct
gccgaactgggactggaagaaaaataa

DBGET integrated database retrieval system