KEGG   Arthrobacter phenanthrenivorans: Asphe3_24850Help
Entry
Asphe3_24850      CDS       T01435                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Asphe3_24850
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Asphe3_24850
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Asphe3_24850
Enzymes [BR:apn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Asphe3_24850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2637808..2638914)
Genome map
AA seq 368 aa AA seqDB search
MAHQWRGVIREYADRLPVTESTKVITLGEGGTPLVHARKLSELTGSEVYLKVEGMNPTGS
FKDRGMTMAMTAAVASGAQAVVCASTGNTSASAAAYATAAGLKCAVLVPEGKISMGKLSQ
AIAHGATLLQVDGNFDNCLDIARKLGESYPVFLVNSVNPARIQGQKTGAFEIVDALGDAP
DIHVLPVGNAGNITAYWKGYKEYSAPFESETAGTLAPVATRTPAMWGFQASGAAPFVAGH
PITEPDTIATAIRIGNPASWDGAIGARDESGGLIDAVTDEEILNAHRWLSSREGVFVEPG
SAAGVAGLLKKHAAGEVPAGKTIVITVTGHGLKDPQWALRTEDGSDVQPVKVPNDVVTVA
AELGLEEK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaccaatggcgcggcgtcatccgcgaatacgctgaccgtctgcccgtgacggaa
tccaccaaggtcatcaccctcggggagggcggcactccgctggtgcacgcccggaagctt
tccgagctcaccggttccgaggtctacctgaaggtggagggcatgaaccccaccggatcc
ttcaaggaccgcggcatgaccatggccatgacagctgccgtcgcttccggcgcccaggcc
gtcgtgtgcgcctccaccggcaacacctctgcttccgcagccgcgtatgccaccgcggcc
ggcctcaagtgcgcagtgctggtgcccgagggcaaaatctccatgggcaagctcagccag
gccatcgcccacggcgccacactgctgcaggtggacggcaacttcgacaactgcctggac
atcgcacggaagctgggggagtcctaccccgttttcctggtcaactccgtcaaccccgcc
cgtatccagggccaaaagaccggtgccttcgaaatcgtggacgcactgggtgacgccccg
gacatccacgtcctgccggtgggcaacgccggcaacatcaccgcctactggaagggctac
aaggagtactccgctcccttcgagtccgaaaccgccggcaccctggccccggtagccacc
aggactcctgccatgtggggcttccaggcatctggcgccgccccgttcgtggccggccac
cccatcacggaaccggacaccatcgccacggcgatccgcatcggcaaccccgcgtcatgg
gacggcgcgatcggtgcccgcgacgagtccggcgggctcatcgatgccgtgacggacgag
gaaatcctcaacgcccaccgctggctgtcttcgcgtgaaggtgtgtttgttgagcccgga
tcggcagccggcgtggccggtttgctgaagaagcacgctgcaggcgaggtcccggccggt
aagacgatcgtcatcacggtcacgggacacggactcaaggacccgcagtgggccttgcgc
accgaggacggcagcgatgtccagccggtcaaggttcccaatgatgtggtcactgttgct
gccgaactgggactggaagaaaaataa

DBGET integrated database retrieval system