KEGG   Arthrobacter phenanthrenivorans: Asphe3_26330Help
Entry
Asphe3_26330      CDS       T01435                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Asphe3_26330
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Asphe3_26330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2813455..2814915)
Genome map
AA seq 486 aa AA seqDB search
MGSSAETSGTALVVGGGISGLLSARGLAAAGYQVTVLEAGTEWGGCVGSHTLAGLTLDSG
AESFAIRSDAVAGLAAELGLSGRIVPPRAGGAWVQLPDGPRELPKTGVLGIPANPWDPEV
RRSLGIPGTLRASLDRILPASVGTRAEVISVSALVRARMGKRVLERLVAPVVGGVHSADP
GLLDVDMVAPGLRAGLRQHGSLAEAVSAQRRLRRVPSADSGDTPASTGPAKAGSAVAGLE
GGMHTLITALVADLRRRGVKLLSGTPATSVSRMGGGWRVGTAGATFDGGLLVVAVEGPAA
VELLEGQVPAFAGQRPPAGPDVKLVTLVLDNPDLDRRPRGTGVLVAPQTPGIEAKALTHA
TGKWDWLAAAAGPGRHVVRLSYGRVDGAGGQAGGPDTDEELLAAALRDTETLLQAGISRG
QLVDWDVVRWRGSLPFAAVGHRARVAGIREACTAAGNLAVVGGWVAGNGLAAVVSDTDEQ
IRNLVH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagttcggcggaaacctccggaacagcgctggttgtgggcggcggcatctccgga
ctgctgtccgcccgggggctcgccgccgccggttaccaggtcaccgtcctcgaagccggg
accgaatggggcggctgcgtgggcagccacacccttgccggcctgacactggacagcggt
gcggaatcgttcgccatccggtccgatgccgtggcgggcctggccgccgagcttggcctg
tccggcaggatcgtcccgccgcgggccgggggagcctgggtccagttgccggacggcccc
cgcgaattgcccaagacgggtgtgctgggaattccggccaacccctgggacccggaggtc
cgccggtcgctcggaatcccgggcacgctgcgggcctcgctggacagaatcctgcctgct
tcggtagggaccagggccgaggtcatcagcgtgtccgcactggtccgggcgcgcatgggc
aagcgcgtcctggagcgcctggttgctccggtggtgggtggcgtgcattcggctgatccg
ggactgctggatgtcgacatggtggcccccggcctgcgcgccggactgcggcagcatggc
tccctggcggaagccgtctcggcccagcggcgcctgcggcgcgtgccgtctgcggactca
ggggataccccggcaagcacagggcccgccaaggcaggctctgccgttgcgggcctggaa
ggcgggatgcacacgctcatcacagccctggtggccgacctccgccgccggggagtgaaa
ctcctttccggcacccccgccacatcggtgtcgcgcatgggcgggggatggcgcgtcggt
acagcaggagcaacgttcgacggcggcctgctggtggtcgctgtggaaggtcccgccgcc
gtcgagctgctggaaggccaggttcccgcctttgccggacaacgcccgccggccggccct
gacgtcaaactggtcacgctggtgctggacaaccctgacctggaccggaggccccggggc
accggtgtcctggtggcaccgcagaccccgggcattgaggccaaggcgctcacgcatgcc
accggcaaatgggactggctggccgcggcggccgggcccgggcggcacgtggtccggctc
tcttacggacgcgtggacggtgccggtggccaggccggcggccccgacacggacgaagag
ctccttgctgcggcactgcgcgacaccgaaaccctcctgcaagccggcatctcccgcggg
cagctggtggattgggacgtggtccggtggcgtggttccctgcccttcgctgctgttgga
caccgcgcccgcgtagccggaatcagggaagcctgcactgccgcgggcaaccttgccgtg
gtggggggctgggtggccggcaatggcctggccgccgtggtgtccgacacggatgaacaa
atccgaaacctggtgcactga

DBGET integrated database retrieval system