KEGG   Arthrobacter phenanthrenivorans: Asphe3_27090Help
Entry
Asphe3_27090      CDS       T01435                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Asphe3_27090
   00052 Galactose metabolism
    Asphe3_27090
   00500 Starch and sucrose metabolism
    Asphe3_27090
   00520 Amino sugar and nucleotide sugar metabolism
    Asphe3_27090
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Asphe3_27090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2887390..2888199)
Genome map
AA seq 269 aa AA seqDB search
MLPVVDKPAIQYVVEEAVNVGLNDVLMITGRNKRALEDHFDRVPSLESTLQGKGDTEKLA
SIQAASNLGDIHYVRQGDPHGLGHAVLRAKQHVGDEAFAVLLGDDLIDARDELLSTMIEV
QAKTGGSVIALIEVEPSQISAYGCADIEQVDGESYVRVKRLVEKPNVEEAPSNLAVIGRY
VLHPAVFDVLERTGPGRGGEIQLTDALQELASADGEGSGVYGVVFRGRRYDTGDKLSYLK
ACVQLAIDSEDLGPGLREWLPGFTAGLSK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcttcccgtcgtggacaagcctgccatccagtacgtggttgaggaagcggtaaacgtc
ggccttaatgatgtcctgatgatcaccgggcggaacaagcgggcgctggaagaccacttc
gaccgcgtgccctcccttgaatccacccttcagggcaaaggcgacacggagaaactcgca
tccatccaggcggccagcaacctgggagacatccactacgtccggcagggagacccgcac
ggactgggccacgccgtgctgcgggcaaagcagcacgtcggcgatgaagcctttgccgtg
ctgctgggggatgacctcatcgacgcgcgagatgagctcctcagcaccatgattgaggtg
caggccaagacgggcggctcggtgattgcgctgattgaagtggaaccttcccagatcagc
gcctacggctgcgcggacattgagcaggtcgacggcgaatcgtacgttcgcgtcaagagg
ctggtggagaagccgaatgttgaggaagccccctccaacctggccgtcattggcaggtac
gtcctccaccccgccgtgtttgatgtcctggagcgcaccggtcccgggcggggcggggaa
atccagctgaccgatgccctgcaggaactggcctccgcagacggcgagggaagcggggtc
tacggcgttgttttccgtggccgccggtacgacaccggagacaagctcagctaccttaag
gcctgcgtccagctggcaatcgacagcgaggaccttgggcccggcctgcgggaatggctg
cccggcttcacagccggcctgtccaagtag

DBGET integrated database retrieval system