KEGG   Arthrobacter phenanthrenivorans: Asphe3_27340Help
Entry
Asphe3_27340      CDS       T01435                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Asphe3_27340
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Asphe3_27340
Enzymes [BR:apn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Asphe3_27340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2918498..2919949)
Genome map
AA seq 483 aa AA seqDB search
MAAMTTEQKAGQVLLPFFKGKDVEAQAALIERLHLAGSIIMGDNVPLDAQGRMDVQGMAA
INQRLAQAAAAGGRPWPGIIAVDQEGGQVARLGPPLTEWPTPMSYGAAGSAPLAKDAGQG
LAAELVPLGFNVDFAPDTDVTIGPRDPTIGARSMSSDPGTAASLGVAFSQGMLAAGVLPA
VKHFPGHGSVTVDSHVNLPVQPAPLAELSVRDWKPFEAAIAAGSPMVMTGHIAVPALEPG
VPASLSGPTYAALRGLGFKGVAVTDALNMGAVAKQYPGGTAAVMALAAGADLLLMPADVG
QAHAGIVQAVASGALPAERLDDAARRVATMMVWNSRTAAKTGAPAGSGAALSARISAQAV
TVLTGACSGPLVPGAVQVAGGQPADRARFEAAATRAGLALGSGPVVSLIGFGGRGAGGDI
AVALDAPWPLQDSTAPVKMALYGRSDGAFDALAAVLAGKAPAPGKLPAAVGGFPAGTGCP
SPN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtggccgcaatgaccaccgaacagaaagcggggcaggtcctgcttccgttcttcaagggc
aaagacgtggaagcgcaggcggccctgatcgaacggctgcacctggccgggtccatcatc
atgggcgacaacgttccgctcgatgcgcagggccggatggacgtgcagggcatggcagcc
atcaaccagcggctcgcccaggccgcagccgccggcggcaggccctggcccgggatcatt
gccgtggaccaggaaggcggccaggttgcccggctggggccgccgctgacggaatggccc
acgcccatgagctacggcgccgccgggagcgcgcccctggcgaaggacgcgggccagggg
ctggcggcggagctggtccctctgggcttcaatgtggatttcgctccggatacggatgtc
accatcggcccgagggaccccaccatcggtgccaggtccatgtcctcggaccccgggact
gccgcttcccttggcgtcgccttttcccagggaatgctcgccgcgggagtgttgcctgcg
gtcaagcacttcccggggcacggatcggtgaccgttgactcgcacgtcaacctccccgtg
cagcccgcccctcttgcagaactcagcgtccgcgactggaagcccttcgaggccgccatc
gctgccggctcgccgatggtgatgacggggcacattgcggtccctgcgctggaacccggc
gtcccggcgtcgctctccggccccacctatgccgcgctgcgggggctgggcttcaaaggc
gtggcggtgacggacgccctgaatatgggcgccgtggccaagcagtaccccggcggaacc
gccgcagtgatggccctcgccgccggcgccgacctcctgctgatgccggccgacgtgggg
caggcgcatgccggcatcgtccaggcggtggcgtccggcgcgctgcccgccgagcggctg
gatgacgcagcgcggagggtggccacgatgatggtgtggaacagccggacggcagcgaaa
accggcgccccggccggaagcggcgcagcactctcagcccggatctcggcgcaggccgtt
accgtcctcacgggtgcgtgcagcggccccctggtgcccggtgctgtccaggtggccggc
ggccagccggcggacagggcacggttcgaggctgcggcaacccgcgccgggctggctctc
ggttcgggaccggtggtcagcctgatcggcttcggcgggcggggcgcgggaggggacatc
gccgtcgcactcgatgctccctggcccctgcaggactcaaccgcgccggttaagatggcc
ctttacggccggagcgacggcgcctttgacgccctcgccgcggtcctcgccgggaaggcg
cccgcccccgggaagctgccggccgccgtcggaggattcccggcaggcaccggctgcccc
tctcccaactaa

DBGET integrated database retrieval system