KEGG   Arthrobacter phenanthrenivorans: Asphe3_28480Help
Entry
Asphe3_28480      CDS       T01435                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_28480
   01230 Biosynthesis of amino acids
    Asphe3_28480
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_28480
   00030 Pentose phosphate pathway
    Asphe3_28480
   00051 Fructose and mannose metabolism
    Asphe3_28480
   00052 Galactose metabolism
    Asphe3_28480
  Energy metabolism
   00680 Methane metabolism
    Asphe3_28480
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Asphe3_28480
Protein phosphatases and associated proteins [BR:apn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Asphe3_28480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3029720..3030745
Genome map
AA seq 341 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGAVLKGIAIHGHEFVGFLDGWRGVVEGDIIDIPRTMVRGI
AKQGGTILGTSRTNPFENGGGPEVIKGHMERLGIDAIIAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATEAIDRLRTTGESHHRCMIAEVMGRHVGWIALHA
GMAAGAHAILIPEQKVSIEQITEWVKEAHARGRAPLVVVAEGFVPEHMESPHSERGLDTF
GRPRLGGIADQLAPELEARTGIETRSTILGHIQRGGVPSAFDRVLATRLGMAAIDSVVEG
YWGTMVALKGTDIEHVGFQEALGKLKTVPQKRYDEAAVLFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattggaatccttaccagcggtggcgactgccccggattgaacgcggtgatccgc
ggagccgtcctcaaaggcatcgcgatccacggccacgaattcgtcggtttcctcgacggc
tggcgcggcgttgttgagggcgacatcatcgatattccccggaccatggtccgtggcatc
gcgaaacagggcggcaccatccttggtacgtcccgcaccaaccccttcgaaaacggcggc
ggccccgaggtcatcaaaggccacatggagcgcctgggcatcgacgcgatcatcgcgatc
ggtggtgaaggaaccctggccgcagccaagcggctcacggatgccgggctgaagatcgtg
ggtgttcccaagaccgtggacaacgaccttgacgccaccgactacaccttcggcttcgac
accgccgtccagatcgccaccgaagccatcgaccggctccgcaccaccggcgaatcgcac
caccgctgcatgattgccgaagtcatgggccggcacgtgggctggatcgccctgcacgcc
ggcatggccgcgggcgcccacgccatcctcatcccggagcagaaggtcagcatcgagcag
atcacggagtgggtgaaggaggcccacgcccgtggccgcgcaccgctggtggtggtggct
gaaggctttgttccggagcacatggaatcgccgcactcggaacgcggccttgacaccttt
ggccggccccgcctgggcggcatcgccgaccagctcgccccggaactcgaagcccgaacc
ggcatcgaaacccgctccaccatcctgggccacatccaacgcggcggcgtgccctcagcc
tttgaccgcgtcctagccacccgcctgggcatggcagccattgattccgtggtggaaggc
tactggggcacgatggtggcgctcaagggaacggacatcgagcatgtgggcttccaggag
gccctgggcaaactgaagaccgtgccgcagaagcgctacgacgaagccgccgtcctcttc
ggctga

DBGET integrated database retrieval system