KEGG   Arthrobacter phenanthrenivorans: Asphe3_29180Help
Entry
Asphe3_29180      CDS       T01435                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Asphe3_29180
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_29180
  Lipid metabolism
   00071 Fatty acid degradation
    Asphe3_29180
  Amino acid metabolism
   00350 Tyrosine metabolism
    Asphe3_29180
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Asphe3_29180
   00626 Naphthalene degradation
    Asphe3_29180
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Asphe3_29180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3095088..3096098)
Genome map
AA seq 336 aa AA seqDB search
MQAAVVTEFGRDLQVQDLEIPTPGPGQALVKVLTTGVCHTDLHAAEGDWPVKPSPPFIPG
HEGVGEVVALGEGVTDLALGDLVGNAWLWSACGDCQYCRTGWETLCEAQQNGGYSVDGSF
GEYMLVDTRFAARIPAGSDPVEVAPVLCAGVTVYKGLKMTETRPGQWVTISGIGGLGHIA
VQYAVAMGLRVAAVDIADDKLALAKSHGAELTVNALHEDPVEVIQRETGGCHGVLVTAVH
PSAFGQAIGMARRGGTIVFNGLPPGDFPAPIFEIVLKGLTVRGSIVGTRQDMEEALDFYA
QGKIHPTVSVRELSEINAVLDEMRHAKIDGRVVLRF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagcagtagtaaccgaattcggcagggacctgcaggtccaggacctggagatt
ccaactcccggcccgggacaggcgctggtcaaggtcctcaccaccggcgtctgccacacc
gaccttcacgcagccgaaggtgattggcccgtcaagccctccccgcccttcatccccggc
cacgaaggcgtgggcgaagtggtggccctcggcgaaggggtcaccgaccttgcgctgggt
gacctggtgggcaacgcctggctctggtccgcctgcggggactgccagtattgccgcacc
ggatgggaaaccctgtgcgaggcgcagcagaacggcggctacagcgtggatggttcgttc
ggcgagtacatgctcgtggacacccgcttcgccgcccgcataccggcgggatccgacccc
gtcgaggtggcgccggtgctctgcgccggcgtcaccgtctacaagggcctgaagatgacc
gagacccggccggggcagtgggtcaccatctccggtatcggcgggctgggccacatcgcg
gtgcagtacgccgtggccatgggcctccgggtggcggcggtagacatagccgatgacaag
cttgccctggccaaatcccacggcgccgagctgacggtcaacgctttgcatgaggatccg
gtagaggtcatccagcgtgaaacgggagggtgccatggagtgctcgtcacggcagtgcac
ccctcggctttcgggcaggccattggcatggcccgccgtggcggcaccatcgtattcaac
gggctgccgccgggggacttccctgccccgatcttcgagattgtgctcaagggactgacc
gtacgcggctccattgtgggaaccaggcaggacatggaggaagccctggacttctacgcg
cagggcaagatccatcccacggtgtccgtccgtgagctttcagagatcaatgcggtgctc
gatgaaatgaggcacgccaagatcgacggacgcgtggtcctgaggttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system