KEGG   Arthrobacter phenanthrenivorans: Asphe3_29980Help
Entry
Asphe3_29980      CDS       T01435                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_29980
   01230 Biosynthesis of amino acids
    Asphe3_29980
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asphe3_29980
   00030 Pentose phosphate pathway
    Asphe3_29980
   00051 Fructose and mannose metabolism
    Asphe3_29980
   00052 Galactose metabolism
    Asphe3_29980
  Energy metabolism
   00680 Methane metabolism
    Asphe3_29980
Enzymes [BR:apn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Asphe3_29980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3184304..3185266)
Genome map
AA seq 320 aa AA seqDB search
MEASQPAVARQILTLTVNPALDVSTSTEEVVSVHKLRCAASRVDPGGGGVNVSRVVHRLG
GRSIAMYTAGGPVGEAYRRLIEAEHLPSLVVPIQGSTRENFTVDETSTGKQYRFVLEGPE
LSEAEWRGCLDLVAQAVPTGGYVVASGSLPPGVPDDFYARVVRLARQVGAHCIVDTSGPA
LREALAEGVFLVKPSKRELGEYLGASLGSEQEEVEAASELVAAGAAQYVALTLGDAGAVL
ASKSGVLRLPVPAVQVRSTVGAGDSFLAAFVLRLAQGRTAEEAFRAAVAAGSAAVMSPAT
ELCHREDVERLEAGLSASTP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggaagcctcgcagcccgccgtcgcacggcaaatcctcaccctgacagtgaaccccgcc
ctggatgtcagcacgtcaaccgaagaggtggtgagcgtccataagctgcggtgcgcggcc
agccgggtggatcccggcggcgggggagtgaacgtttcgcgggtggtccaccggctcggc
gggcgcagcattgccatgtacaccgccggtggtcccgtgggcgaagcctaccgccgcctc
atcgaggcggagcatctccccagcctggtggtgcccatccagggcagcacccgggagaac
ttcaccgtggacgagacctccacgggcaagcagtaccggtttgtcctggaaggccccgaa
ctcagcgaggctgagtggcgcgggtgcctggacctggttgcccaagcggtcccgacaggc
ggatatgtagtggccagcgggagcctcccgcccggagttccggacgatttctacgcccgc
gtggtccgcctggcccggcaggtcggggcgcactgcatcgtggacacgtccgggccggca
ctgcgcgaggcgctcgccgaaggcgtcttcctggtcaagcccagcaagcgcgaactgggg
gagtacctcggggcgagcctcggcagtgaacaggaagaggtggaagctgcatctgaactc
gtggcggccggagcggcccagtacgttgcactcaccctcggcgacgccggggctgtgctg
gcttcaaagtcaggcgtcctccggttgccggttccggccgtccaggtacgcagcaccgtg
ggcgccggggacagcttcctggcagccttcgtgctccggctggcacaggggcggactgcg
gaggaggcgttccgtgctgccgttgcggccgggtcagctgccgtgatgtcgcctgccacc
gaactctgccacagggaggacgtggaacgcctggaagccgggctttccgcttccacccct
tag

DBGET integrated database retrieval system