KEGG   Arthrobacter phenanthrenivorans: Asphe3_30800Help
Entry
Asphe3_30800      CDS       T01435                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Asphe3_30800
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Asphe3_30800
   00630 Glyoxylate and dicarboxylate metabolism
    Asphe3_30800
Enzymes [BR:apn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Asphe3_30800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3276110..3277726
Genome map
AA seq 538 aa AA seqDB search
MPLTSPAHLPFHRAAEILTPEALEFLAELHRRFASERDTRLAARQERRAEAGKTGTLDFL
PETAAVREGDWTVAPVPPALQDRRVEITGPCSPAKMAINALNSGAKVWLADLEDASCPTW
FNVIDGQLSLYDATRGTLAYTSPEGKTYALRTDAPTAVVIMRPRGWHMDERNLEFDGKPA
IGALVDFGLHFFHNAKRLLDNGHGPYYYLPKMESHLEARLWNEIFVFAQDALGIPQGTIR
ATVLVETIPAAFEMDEILYELRDHASGLNAGRWDYLFSIIKYFRDSGSKFTLPDRAAVSM
TVPFMRAYTELLVKTCHQRGAFAMGGMAAVIPNRRQPEVTEEAFAKVRADKTREANDGFD
GSWVAHPDLVSICMEVFDGVLGDASNQVQRTRPEVHVTAEQLLDIESAPGEATEAGLRGN
LYVSVAYTAVWLSGNGAVAIHNLMEDAATAEISRSQVWQQIRNEVVYADTGNTATRELVE
RLLAEETEKLRNEVGEELFSRYYEPASRIISEICLSEDYTDFLTTPAYEVLESEMAAR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgacctcacccgcccacttgcccttccaccgcgcggcggaaatcctgacgccg
gaagcccttgagttcctggccgaactccacaggcgcttcgcctccgaacgggatacgcgt
cttgctgcgcgtcaggagcgccgcgcagaggccggaaagaccggcaccctggacttcctg
ccggagacagcagcagtgcgggagggtgactggaccgtcgccccggtgccgcccgccctt
caggaccgccgggtggaaatcaccggcccctgttctcctgcgaagatggcgatcaacgcc
cttaactcgggagccaaagtctggctggcagacctcgaggacgccagctgcccaacgtgg
ttcaacgtcatcgacggccagctctcgctgtacgacgccacacgcggaaccctggcctac
acctcgcccgagggcaaaacctacgccctgcgcaccgacgcgcccaccgccgtcgtcatc
atgcgcccccgcggttggcacatggatgagcggaacctggagttcgatggcaagcccgcc
atcggcgccctggtggactttggactacatttcttccacaacgcgaagcggctcctcgac
aacggccatggcccctattactacctgcccaagatggaaagccaccttgaagcccgtctg
tggaacgaaatcttcgttttcgcgcaggacgccctcggcatcccgcagggaactattcgg
gctaccgtgctcgtggaaaccattcccgccgcttttgagatggacgagatcctgtacgaa
ctccgcgaccacgcctccgggctgaacgccggacgttgggattacttgttcagcatcatt
aagtatttccgcgattccggttcaaagttcacgctgcctgaccgtgccgcggtatcgatg
acagttccctttatgcgcgcctacaccgaactgctggtcaagacctgccaccagcgcggc
gcgtttgccatgggcggcatggcagccgtcattccgaaccgccgccagccggaagtcacc
gaagaggcgttcgcaaaagtaagggctgacaagacccgcgaggccaacgacggattcgac
ggctcctgggttgcacacccggacctcgtttccatctgtatggaggtgttcgacggggtt
ctcggggacgcctcaaaccaagtgcagcgaacccgccccgaggtccacgtcaccgccgaa
cagttgctcgacatagagtcggcgcccggcgaggccaccgaggccggtctccgcggaaac
ctgtacgtttctgtcgcctacactgcagtatggctgtccgggaacggggccgtcgccatc
cacaacctcatggaagacgccgcaacggcggaaatctcacggtcgcaagtctggcagcag
atccgcaacgaagtggtttacgcggacaccgggaacacggcaacccgggaactggttgaa
cgtctgttggccgaggaaacggaaaagctccgcaacgaggtgggcgaggaactgttcagc
cggtactacgagccggcatcccgcatcatttcggagatctgtctctccgaggattacacc
gacttcctcaccacaccggcctacgaggtactggaatcagaaatggcggcccggtag

DBGET integrated database retrieval system