KEGG   Arthrobacter phenanthrenivorans: Asphe3_32560Help
Entry
Asphe3_32560      CDS       T01435                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Asphe3_32560
Enzymes [BR:apn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Asphe3_32560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3452423..3454438
Genome map
AA seq 671 aa AA seqDB search
MTQQANPRPASVWNNVEGIAFGGDYNPEQWPVSVRLEDLELMQEAGVNFLSVGIFSWALL
EPAEGHYDFGWLDEVMDNLHGIGVKVALATATAAPPAWLVRKHPEILPVTADGTVLGPGS
RRHYTPSSAVYRRYAAGITRVLAERYKNHPALALWHVDNELGCHVSEFYGEEDAAAFRAW
LGRRYGSIEALNAAWGTAFWSQNYGSFDEILPPGVAPSTLNPGQQLDFQRFNSWALMDYY
RELAAVLREVTPGVPCTTNLMASSATKSMDYFSWAGDLDVIANDHYLVAADPERHIELAF
SADLTRGIAGGDPWILMEHSTSAVNWQPRNQPKMPGEMMRNSLAHVARGADAVMFFQWRQ
SFAGSEKFHSAMVPHGGRETRVWREVVDLGAALKLLEPVRGSRVESRVAIVFDYEAWWAS
EIDSKPSIDVRYLDLLRAFHRSLFLRGVAVDIVHPSASLEGYHLVLVCTLYSVTDKAAAS
IAAAASAGATVLVSYFSGIVDEKDHVRLGGYPGAFRELLGVRVEEFHPLLAGSQLKLSDG
TVSSIWSEHVHLEGAEAVQAFTEYPLEGVPSLTRHVVGSGAAWYLATFPDRDGIESIVDR
LLAESGVAPIAVADHGVELTRRRSADGSSFLFAINHTRSDASVEVLGTDLLTGEQFSGSL
PAGSVAVIAES
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcaggcaaacccaagaccagccagcgtatggaacaacgtcgagggcatcgcc
ttcggcggcgactacaaccctgagcagtggcccgtgagcgtgaggctggaagacctggag
ctgatgcaggaggcgggcgtaaacttcctgagcgtcggcatcttttcctgggcactgctg
gaacctgccgaaggacactacgacttcggctggctggacgaggtcatggacaacctccac
ggcattggagtcaaggttgcgctggccaccgccaccgccgctcccccggcctggctggta
cgcaagcatcccgagatcctgcccgtcactgctgacggaaccgtgctgggaccggggtcg
cggcggcactacacgccgtcgtcagccgtttaccggcgctacgccgccggcattacacgg
gtccttgcggaacggtacaagaaccaccccgcgctggcgctgtggcacgtggacaacgag
ctgggctgccacgtctccgagttctacggcgaggaggacgcggctgcattccgcgcctgg
ctgggaaggcggtacggaagcattgaggcgcttaacgcggcctgggggacggcgttctgg
tcccagaactacggctccttcgacgagatcctcccgccgggcgtcgcgccgtcaacattg
aatccagggcagcaactggacttccagcggttcaattcctgggcactgatggactactac
cgcgaactggccgcggtcctgcgcgaagtcacccccggcgtaccctgcactaccaacctg
atggcctcaagcgccaccaaatccatggactacttcagctgggccggggacctggatgtc
atcgccaatgatcactacctcgtggcggcggatcccgaacggcacatcgaactcgccttc
agcgcggacctgacccgtgggatcgccggcggtgacccgtggatcctgatggaacattcg
acgtcggccgttaactggcagccacgcaaccagcccaagatgcccggggaaatgatgcgc
aactcgctggcgcacgtggcgcgcggcgctgatgcagtgatgttcttccagtggcggcag
agctttgcgggatccgagaagttccactcggccatggtgccgcacggcggacgtgaaacc
cgcgtgtggcgcgaagtggtggacctcggtgctgccctgaagctgttggaaccagttcgg
ggttcgcgggtggaatcccgcgttgccatcgtgttcgactacgaggcgtggtgggccagc
gaaatcgactccaagccgagcatcgacgtgaggtacctggacctgctgcgggccttccac
cggtccctgttcctgcggggagttgccgtggacatagtccacccgtcagcttcgctggag
ggctaccacctggtcctggtttgtacgttgtactcggtgaccgacaaggcagcggccagc
attgcggctgctgcctccgcaggcgcgaccgttttggtcagctacttcagcgggattgtc
gacgaaaaggaccacgtgcggctgggcgggtacccgggggcgttccgcgaactcctgggc
gtgcgggtggaggagttccacccgctgctggccgggtcgcagctcaagctgagtgacggc
actgtgtcctcgatctggagcgagcatgtccatcttgaaggggcggaggcagtccaggcc
ttcaccgagtatcccctggagggtgtgccctccttgacccgtcatgttgtgggttccggg
gccgcttggtacctggcaactttccccgaccgtgacggcatcgagtcgatcgtggaccgg
ctcctggccgagtcgggggttgcccccattgctgtcgctgaccacggcgtggaactgacc
cggcggcgttcagccgacggcagcagtttcctgttcgccatcaaccacaccaggtctgac
gcttccgttgaagtgcttggtacggacctgctgacaggcgagcagttctccggttcgctt
cccgcaggaagcgttgcggtgatcgccgaaagttag

DBGET integrated database retrieval system