KEGG   Arthrobacter phenanthrenivorans: Asphe3_33450Help
Entry
Asphe3_33450      CDS       T01435                                 

Definition
uricase (urate oxidase)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:apn00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3559245..3560159
Genome map
AA seq 304 aa AA seqDB search
MTMSSKIILGDNQYGKAEVRVVKITRDTDRHEIEDLNVTSQLRGDFAAAHLEGDNAHVVA
TDTQKNTIYAFARGGVGSPEAFLLRLGEHFTSSFDWVTGGRWEAESYSWNRIQAHGAEHD
HSFVRNGQEVRTAVLVRDGATTHLISGLKDLTVLKSTQSGFVGYPKDKYTTLPETTDRIL
ATDVSARWRFKTGTDFSTVDFNKSYDDVKALLLEGFTEKYSHALQQTLFDMGTKVLEAHS
EIDEIKFSMPNKHHFLVDLSPFGLDNPNEVFYAADRPYGLIEATVQREDAAPADIAWSGI
AGFC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagcagcaagatcatcctcggcgacaaccagtacggcaaggccgaggtccgg
gtcgtcaagatcacccgagacaccgaccgccacgaaatcgaagacctcaacgtcacctcg
cagctgcgcggcgatttcgcggccgcccaccttgagggcgacaacgcccacgtggtggcc
actgacacccagaagaacacgatctacgccttcgcccgcggcggcgtcggctcccccgag
gcgttcctgcttcgcctcggcgagcacttcacctccagcttcgactgggtcaccggcggc
cgctgggaagccgagtcctacagctggaacaggatccaggcccacggcgcagagcacgac
cactccttcgtgcgcaacggccaggaagtccgcaccgcggtgctggtccgcgacggcgcc
acgacccacctgatctccgggctcaaggacctgaccgtcctgaagtccacgcagtcaggc
ttcgtcggctacccgaaggacaagtacaccaccctgcccgaaaccacggaccggatcctg
gccaccgacgtctcggcccgctggcgcttcaagaccggaactgacttcagcacggtggac
ttcaacaagagctacgacgatgtcaaggccctcctgctcgaagggttcacggagaagtac
tcccacgccctgcagcagacgctgttcgacatgggcaccaaggtgctggaagcgcacagc
gagattgacgagatcaagttctcgatgcccaacaagcaccacttcctcgtcgatctctcc
cccttcggcctcgacaaccccaacgaggtcttctacgccgccgaccgcccctacggcctg
atcgaggctacggtccagcgcgaggacgccgccccggcggacatcgcatggtccggcatc
gccggcttctgctag

DBGET integrated database retrieval system