KEGG   Arthrobacter phenanthrenivorans: Asphe3_33450Help
Entry
Asphe3_33450      CDS       T01435                                 

Definition
uricase (urate oxidase)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Asphe3_33450
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Asphe3_33450
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Asphe3_33450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3559245..3560159
Genome map
AA seq 304 aa AA seqDB search
MTMSSKIILGDNQYGKAEVRVVKITRDTDRHEIEDLNVTSQLRGDFAAAHLEGDNAHVVA
TDTQKNTIYAFARGGVGSPEAFLLRLGEHFTSSFDWVTGGRWEAESYSWNRIQAHGAEHD
HSFVRNGQEVRTAVLVRDGATTHLISGLKDLTVLKSTQSGFVGYPKDKYTTLPETTDRIL
ATDVSARWRFKTGTDFSTVDFNKSYDDVKALLLEGFTEKYSHALQQTLFDMGTKVLEAHS
EIDEIKFSMPNKHHFLVDLSPFGLDNPNEVFYAADRPYGLIEATVQREDAAPADIAWSGI
AGFC
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgagcagcaagatcatcctcggcgacaaccagtacggcaaggccgaggtccgg
gtcgtcaagatcacccgagacaccgaccgccacgaaatcgaagacctcaacgtcacctcg
cagctgcgcggcgatttcgcggccgcccaccttgagggcgacaacgcccacgtggtggcc
actgacacccagaagaacacgatctacgccttcgcccgcggcggcgtcggctcccccgag
gcgttcctgcttcgcctcggcgagcacttcacctccagcttcgactgggtcaccggcggc
cgctgggaagccgagtcctacagctggaacaggatccaggcccacggcgcagagcacgac
cactccttcgtgcgcaacggccaggaagtccgcaccgcggtgctggtccgcgacggcgcc
acgacccacctgatctccgggctcaaggacctgaccgtcctgaagtccacgcagtcaggc
ttcgtcggctacccgaaggacaagtacaccaccctgcccgaaaccacggaccggatcctg
gccaccgacgtctcggcccgctggcgcttcaagaccggaactgacttcagcacggtggac
ttcaacaagagctacgacgatgtcaaggccctcctgctcgaagggttcacggagaagtac
tcccacgccctgcagcagacgctgttcgacatgggcaccaaggtgctggaagcgcacagc
gagattgacgagatcaagttctcgatgcccaacaagcaccacttcctcgtcgatctctcc
cccttcggcctcgacaaccccaacgaggtcttctacgccgccgaccgcccctacggcctg
atcgaggctacggtccagcgcgaggacgccgccccggcggacatcgcatggtccggcatc
gccggcttctgctag

DBGET integrated database retrieval system