KEGG   Arthrobacter phenanthrenivorans: Asphe3_33490Help
Entry
Asphe3_33490      CDS       T01435                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:apn00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:apn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3564360..3565958
Genome map
AA seq 532 aa AA seqDB search
MAITVTDPRPIDRAEEILTPKALAFVEELHNRFAGTRNELLQARAAKRQRVAETGKLDFL
PETKDVRDGDWKVAPAPAALQDRRVEMTGPASPAKMAINALNSGAKVWLADLEDASTPTW
GNVIDAILNLRDAAQGTLSYTSDEGKEYRLRTDAPLAVVVARPRGWHMQEKHLLVNGEPA
VGALVDFGLHFFHVAKQLVLNGQGPYYYLPKMESHLEARLWNDVFVFAQDYLGLGQGTVR
ATVLIETIPAAFEMDEILYELRDHASGLNAGRWDYLFSIIKYFRDAGEEFVLPDRASVAM
TAPFMRAYTELLVKTCHKRGAFAMGGMAAVIPNRRHPEVTEAAFAKVRADKTREANDGFD
GSWVAHPDLVPTCREVFDSVLGDKPNQVDKQRPEVNVTAEQLLDVSSADGQVTEAGLRLN
LYVAVAYTAVWLSGNGAVAIHNLMEDAATAEISRSQVWQQIRNKSVLADTGNTVTRELVE
RILGEETERLRTEFGDEAFRRYYQPASELIADICLSEDYTDFLTTPAYELVG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccatcactgtcacagacccccggcccatcgaccgcgcggaggaaatcctcaccccc
aaggcactggccttcgtggaggaactgcacaaccgcttcgccggcacgcgcaacgaactc
ctgcaggcccgtgccgccaagcggcagcgcgtcgcggagaccggcaagctggacttcctg
ccggagaccaaggacgtgcgcgacggcgattggaaggttgcgcccgccccggccgccttg
caggaccgcagggtcgagatgaccgggccggcctcgccggcgaagatggccatcaatgca
ctgaactccggcgccaaggtgtggctcgcggacctcgaggacgccagcacccccacctgg
ggcaacgtcatcgacgctatcctgaacctccgcgatgccgcccagggcaccctcagctac
acctcggacgagggcaaggagtaccggctccgcacggacgcgccgctcgccgtcgtggtg
gcccgcccccgtggctggcacatgcaggaaaagcacctgctggtcaacggcgaaccggcc
gtcggtgcgctggtggacttcggcctgcacttcttccatgttgccaagcagctggtgctc
aatgggcagggaccgtactactacctgcccaagatggaaagccacctcgaagcccggctc
tggaacgatgtgttcgttttcgcgcaggactacctgggactgggccagggcaccgtcagg
gccactgtgctgatcgagaccatcccggcagccttcgagatggacgagatcctctacgaa
ctgcgcgaccacgcctcgggcctgaacgccggccgctgggactacctgttcagcatcatc
aagtacttccgcgacgccggcgaggagtttgtgctcccggaccgcgcttccgttgccatg
actgccccgttcatgcgtgcctacaccgaactgctggtgaaaacctgccacaagcgcggt
gccttcgccatgggcggcatggcggcagtcattcccaaccggcggcaccctgaggttacc
gaggcagccttcgccaaggtccgcgcggacaagacccgcgaggcgaacgacggctttgac
ggttcttgggtggcgcacccggacctggtaccgacctgccgcgaggtctttgactcggtg
ctgggagacaaaccgaaccaggtggacaagcagcgcccggaggtcaacgtcacggcagaa
cagttgctggatgtctcctccgccgacggccaggtgaccgaggccgggctgcggctgaac
ctctacgtcgccgtggcctacacggcggtctggctgtccgggaacggcgccgtggccatc
cacaacctgatggaggatgccgcgacggcggagatctcccggtcccaggtgtggcagcag
atccggaacaagtcagtgctcgcggacaccggcaacacggtcacccgcgagctcgtggag
cggatcctcggcgaagaaaccgaacggctccgcaccgagttcggtgacgaggcgttccgg
cgctactaccagccggccagcgaactgattgccgacatctgcctctcggaggactacacc
gacttcctcaccacccccgcctacgaactggtgggctga

DBGET integrated database retrieval system