KEGG   Pseudarthrobacter phenanthrenivorans: Asphe3_34500Help
Entry
Asphe3_34500      CDS       T01435                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
apn  Pseudarthrobacter phenanthrenivorans
Pathway
apn00625  Chloroalkane and chloroalkene degradation
apn00680  Methane metabolism
apn01100  Metabolic pathways
apn01120  Microbial metabolism in diverse environments
apn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Asphe3_34500
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Asphe3_34500
Enzymes [BR:apn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Asphe3_34500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP HI0933_like FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADX74552
UniProt: F0M4K5
Position
3660843..3662060
Genome map
AA seq 405 aa AA seqDB search
MSGNRAVAYKEPGVVEIIDTDYPTLELKDGPGVNPANVGRKVPHGAILRTVTTNICGSDQ
HMVRGRTTAPKDLVLGHEITGEVVEVGPDVEFIKVGDIVSVPFNISCGRCRNCKERKTGI
CLNVNPDRPGSAYGYVDMGGWVGGQAEYVLVPYADWNLLKFPDRDQALEKIMDLTMLSDI
FPTGFHGAVTAGVGVGSTVYIAGAGPVGLAAAVGAQLLGAAVVIVGDMNEDRLAQARSFG
CETVNVTKGDPKDQIEQILGVPEVDCGVDAVGFEARGHGKDASHEAPATVLNSLMDITAA
GGALGIPGLYVTGDPGGIDEAAKHGSLSLSLGTGWAKSLSFTTGQCPVMSYNRQLMMAIL
HDKVQIAKAVNATAIPLEDAPRGYAEFDAGSATKFVLNPNGYVKA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaaacagagccgttgcctacaaagaacccggtgtcgtcgaaatcatcgacacc
gactacccgacgttggaactcaaggatggtcccggcgttaatccggccaatgtgggccga
aaagtaccccacggcgcgatcctgcgaacggtgaccaccaatatttgcggctcggaccag
cacatggttaggggccggaccacggcccctaaggacctcgtccttggccacgaaatcacc
ggcgaagtggtggaggtcggtccggacgtggagttcatcaaggtgggagacattgtctcc
gtacctttcaatatctcctgcggccgttgccggaactgcaaggaacggaagaccggcatc
tgcctgaacgtcaacccggaccgcccgggcagcgcctacggttacgtggacatgggcggc
tgggtgggcggccaggcggaatacgtgctggtcccctacgctgactggaacctgctgaag
ttcccggaccgcgaccaggccctggaaaagatcatggacctgaccatgctttcggatatt
ttccctacgggcttccacggcgccgtcactgccggggtgggcgttgggtccaccgtctac
attgccggtgcaggcccagtgggcctcgcggccgccgtcggcgcgcagctgctcggtgcc
gccgtcgtcattgtcggtgacatgaacgaagaccggctggctcaggcccgctccttcggc
tgcgaaacggtgaacgtcaccaagggcgatccgaaggaccagatcgagcaaatccttggc
gtccccgaggtggattgcggcgtggacgccgtagggttcgaagcccgcggtcacggcaag
gacgcctcccacgaggcccccgccaccgtgctgaactccctcatggacatcaccgctgct
ggcggggcccttggcattcccggtctgtatgtcaccggcgacccgggtggaatcgacgag
gccgcaaagcacggctccctgtccctgtccctgggcaccggatgggcaaagtccctgtcc
ttcacaaccggtcagtgccctgtcatgtcgtacaaccgccagctgatgatggcgatcctg
cacgacaaggtccaaatcgccaaggccgtaaacgccacagcaatcccgcttgaggacgca
ccgcgcggctacgcagaattcgacgccggttcggcaacgaagttcgtgctcaacccgaac
ggatacgtcaaggcgtag

DBGET integrated database retrieval system