KEGG   Arthrobacter phenanthrenivorans: Asphe3_36860Help
Entry
Asphe3_36860      CDS       T01435                                 

Definition
beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
apn  Arthrobacter phenanthrenivorans
Brite
Enzymes [BR:apn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Asphe3_36860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3925009..3926175
Genome map
AA seq 388 aa AA seqDB search
MKVAKLVAAAALASTFVLPTALPAMAGPEDKPQPPGLAKQDTLRWAAPNDVRIGTAVAGG
GHHETMPYANPFTSDAQYREVLAAEFSSVSPENQAKWEFIHPARDQYRFAEMDAIVEFAQ
QNGQVVRGHTLFWHSQNPAWLEQGNFSKDELRSILKDHITTVAGRYAGKVQQWDVANEIF
NGDGTLRTTDNIWIRELGPEIIADAFRWTHEADPNAKLFFNDYGVESINRKSTAYVNLIS
KLLAQGVKVDGFAVQGHLSTRYGFPADLQANLQRFEDLGLETAVTEIDVRMDVPAGTKPT
DEQLAKQASYYQRALDACLNIEGCKSFTIWGFNDKYSWVPVFFGGEGEATVMWEDYTRKP
SYYALQSTLAAATPGGEQRYSHHPAYQR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttgccaaactagtcgccgccgctgcgctggcgtcgacctttgtcctcccaacg
gcattgcctgcgatggcaggcccggaggacaagccgcagccccccggcctcgccaagcag
gacaccctgcgctgggccgcccccaacgatgtccggatcggcacggcagttgccggcggc
ggacatcacgaaaccatgccttacgccaaccccttcacatcggacgcccagtaccgcgaa
gtgctcgcagcggaattcagctccgtgtcacctgagaaccaggcgaagtgggagttcatc
caccccgcccgggaccagtaccgctttgcagagatggacgcgatcgtggaattcgcccag
caaaatgggcaggtggtccgcggccacacactgttctggcacagccagaaccccgcctgg
ctggagcagggcaacttcagcaaggacgaactccgctcgatcctgaaggaccacatcacc
accgtggcgggacggtacgcgggcaaagtccagcagtgggatgttgccaatgaaatcttc
aacggtgacggcaccctccgcaccaccgacaacatctggatccgcgagctggggccggag
atcatcgccgacgccttccgctggacccacgaagccgatccgaacgccaagctcttcttc
aacgactacggcgtggaaagcatcaaccgcaagagcacggcttacgtcaacctcatttcg
aagctcctggcacagggcgtgaaggtcgatggcttcgccgtccagggccacctgagcacc
cgctacggtttccccgcggacctgcaggcaaacctccagcgcttcgaggaccttggcctg
gaaacggccgtcactgagatcgacgtccgcatggacgttcccgccggcaccaagcccacg
gacgagcagctggccaagcaggcgagctactaccagcgggcactggacgcatgcctgaac
attgagggatgcaagtccttcaccatctggggcttcaacgacaagtactcgtgggtgcct
gtcttcttcggcggagagggtgaggcaacggtgatgtgggaggactacacccggaagcct
tcctactacgccctgcagtccaccctggctgcggcaaccccgggcggagaacagcgctac
agccaccacccggcctaccagcggtag

DBGET integrated database retrieval system