KEGG   Arthrobacter phenanthrenivorans: Asphe3_38530Help
Entry
Asphe3_38530      CDS       T01435                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
apn  Arthrobacter phenanthrenivorans
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:apn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Asphe3_38530
   00500 Starch and sucrose metabolism
    Asphe3_38530
Enzymes [BR:apn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Asphe3_38530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4108537..4110447)
Genome map
AA seq 636 aa AA seqDB search
MGRFKPSRRSVLAAVAAGAVTAAAGLSGPAALRAHAAVLQANEPPLDRPHPVIFVVGDST
SAAYQHSERPRAGWGQALPLLLGPQSGVFDCAWSGASSKSFADAGLLDEVVAMLQPGDYL
LISFGHNDEKVQDPARGTDPQTTFKEYLQKYIDGARGSGAKPVLVTPVERRRFSALGVAQ
DSHGSYPQAVRELAAVTQTPLVDLSASSKELWQQLGPEGTKNHFLYADPGRYPQYPDGVA
DNTHFQAEGAFAVAKLVALELQAQQAVPPGYFQHLNDRLDPMQGIHWPSERPVDKPLVLE
VGPGAGFQTVQAAVDAVPAGSTRRTQIRIAPGTYRGTVRVPANKARVSFIGLGEKPEDVV
LVHNNASGTPKPDGTGPFGTGGSASVRIDGTDFTAENLTFSNDFDEAANQEMKNRQAVAL
FLTGDRAVLRNIRCLGNQDTLLVDSPARGVQARSYFAGCYVEGDVDFIFGRGTAVFSGCE
IRSLDRGSGTNNGYVSAGSVNIGIKHGYLFTDCRFVSSAAAGSVHLGRPWHPSGDVDAIA
QVLVRNSWLGSHISETPWTDMSGFSWREARFHEFNNNGPGSRITPTRPQLDPALAAEFTL
EEYLRGTDGWAPHLAGTRMDSATAPSAAGSGTGRPS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgggccgcttcaagcccagccgccgctccgtcctggctgcggtggcagcgggagcagtg
acagcagcggcgggactctcgggaccagccgctctgcgcgcccatgccgccgtcctgcaa
gcgaacgaacctcccttggaccgcccccatccggtcatcttcgtggtgggtgattccacc
tccgcggcctatcagcactcggaacgtccccgggctggctggggacaggcgctccccttg
ctgctggggccgcagtccggcgtgtttgactgtgcctggtccggcgcctcgtccaagagt
ttcgccgatgcgggcttgttggacgaagtggtggccatgctccagccgggcgactacctg
ctcatctccttcgggcacaatgacgagaaggtccaggacccggcgaggggcacggatcca
cagacaacgttcaaggagtacctgcagaaatacattgacggcgccaggggcagcggtgcc
aaacccgtgctggtcaccccggtggaacggcgcaggttcagtgccttgggcgtggcacag
gattcgcacggatcctatccacaggctgtccgtgaactcgccgccgtaacccaaacgccg
ctcgtggacctttccgcctcctccaaggagttgtggcagcagctcgggccggaaggtacc
aagaaccatttcctttatgcagaccccggccgctacccgcagtacccggacggcgttgcc
gacaacacgcacttccaggctgaaggcgccttcgccgtggccaaactggtggctttggaa
ctccaggcgcagcaggcggtgccgcccggttatttccagcacctcaacgaccggcttgac
ccgatgcaagggatccattggcctagcgaacggcctgtggataagccgctggtcctggag
gttggaccgggagcaggtttccagacagtgcaggctgcagttgacgcagtacccgcaggc
agcacgcgccgcacccagatccgcatcgcgcccggcacctaccggggaaccgtccgggtg
ccggccaacaaggcaagagtctcgttcatcgggctgggagagaagccggaggacgttgta
cttgtccacaacaatgcctccggcacccccaagcctgacggcactggcccctttggaacg
ggcggaagtgcgagcgtacggattgacgggaccgacttcaccgcggaaaacctcacgttc
agcaatgacttcgatgaggccgccaaccaggagatgaagaaccgtcaggcggttgcactc
ttcctgaccggagaccgagcggtgctgcgcaatatccgctgcctcggaaaccaggacacg
ttgctggtcgattccccggcccgcggtgtccaggcacggtcctactttgccgggtgctac
gtggaaggggacgtcgacttcatctttggccgggggaccgccgtcttctccggctgtgaa
atccgttccctggaccgggggtccgggaccaacaacggctatgtttccgccggcagcgtg
aacatcgggatcaagcacggctacctgtttacggactgcaggtttgtctccagtgccgca
gcgggttcggtccaccttggccgtccctggcatcccagcggggacgtggacgccatcgcc
caggtgttggtcagaaactcctggctagggtcgcacatctccgaaacgccctggacggat
atgagcggcttctcctggcgggaagcgcggttccacgagttcaacaacaacgggccggga
tcccgcatcacccccacccgcccccagctggatccagccctggccgcagagttcacgctg
gaagagtacctccgcgggacggacggttgggcgccgcacctggcgggcacccggatggac
agcgccaccgcgccgtccgcggccggttcgggaacggggcgaccctcctga

DBGET integrated database retrieval system