KEGG   Archaeoglobus profundus: Arcpr_0032Help
Entry
Arcpr_0032        CDS       T01152                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
apo  Archaeoglobus profundus
Brite
Enzymes [BR:apo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Arcpr_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Ubie_methyltran Methyltransf_25 Methyltr_RsmB-F RrnaAD Methyltransf_3 Fibrillarin Methyltransf_11 GCD14 Methyltransf_32 Methyltransf_23 CMAS DUF938 Methyltransf_4 Methyltransf_9 ADH_zinc_N Met_10
Motif
Other DBs
NCBI-ProteinID: ADB57109
JGI: Arcpr_0032
UniProt: D2RFN4
Position
complement(27353..28009)
Genome map
AA seq 218 aa AA seqDB search
MDPFEEKRRRMVERLKEELGISDKVAKAMLKVPRHLFVPKAYEREAYVDTPLPIGFGQTI
SAPHMVAIMCDLLDLKEGEKVLEVGGGSGYHAAVVAEIVGKKGKVIAIERIPELAERAKE
VLRLLGYDNVKIVVGDGTKGYPEEAPYDKIYVTASAPDIPKPLIEQLKPGGRMVIPIGRY
EQHLYVVDKDESGKIHKRVWGPVRFVPLVGEYGFKEWE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgaggagaaaaggagaaggatggttgagaggctaaaggaggagttggga
ataagcgacaaagttgcaaaggctatgttgaaggttccccgtcacctcttcgttcccaag
gcttacgagagggaagcttacgtcgatactccccttccaataggattcggacagactata
agtgctcctcacatggttgcgataatgtgcgatctgctcgatctcaaagagggagagaag
gttttggaagtaggaggcggaagtgggtatcacgctgcagtcgttgcggagattgttgga
aagaaggggaaagttattgcaatagaaagaattcccgagctcgctgaaagagctaaggag
gttttgaggctcttaggttacgacaacgtcaagatagtcgttggcgatggaactaagggt
taccctgaggaagctccctacgataaaatatacgttaccgcatccgcaccagacattcca
aaacctctcatcgagcagttgaagccgggagggaggatggttattccaataggcagatat
gagcagcatctctacgtagttgataaagatgagagtggaaagattcacaaaagagtttgg
ggacccgtaaggtttgtaccgctcgttggcgagtacgggtttaaagaatgggaatga

DBGET integrated database retrieval system