KEGG   Archaeoglobus profundus: Arcpr_0032Help
Entry
Arcpr_0032        CDS       T01152                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
apo  Archaeoglobus profundus
Brite
Enzymes [BR:apo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Arcpr_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(27353..28009)
Genome map
AA seq 218 aa AA seqDB search
MDPFEEKRRRMVERLKEELGISDKVAKAMLKVPRHLFVPKAYEREAYVDTPLPIGFGQTI
SAPHMVAIMCDLLDLKEGEKVLEVGGGSGYHAAVVAEIVGKKGKVIAIERIPELAERAKE
VLRLLGYDNVKIVVGDGTKGYPEEAPYDKIYVTASAPDIPKPLIEQLKPGGRMVIPIGRY
EQHLYVVDKDESGKIHKRVWGPVRFVPLVGEYGFKEWE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggatccttttgaggagaaaaggagaaggatggttgagaggctaaaggaggagttggga
ataagcgacaaagttgcaaaggctatgttgaaggttccccgtcacctcttcgttcccaag
gcttacgagagggaagcttacgtcgatactccccttccaataggattcggacagactata
agtgctcctcacatggttgcgataatgtgcgatctgctcgatctcaaagagggagagaag
gttttggaagtaggaggcggaagtgggtatcacgctgcagtcgttgcggagattgttgga
aagaaggggaaagttattgcaatagaaagaattcccgagctcgctgaaagagctaaggag
gttttgaggctcttaggttacgacaacgtcaagatagtcgttggcgatggaactaagggt
taccctgaggaagctccctacgataaaatatacgttaccgcatccgcaccagacattcca
aaacctctcatcgagcagttgaagccgggagggaggatggttattccaataggcagatat
gagcagcatctctacgtagttgataaagatgagagtggaaagattcacaaaagagtttgg
ggacccgtaaggtttgtaccgctcgttggcgagtacgggtttaaagaatgggaatga

DBGET integrated database retrieval system