KEGG   Archaeoglobus profundus: Arcpr_0080Help
Entry
Arcpr_0080        CDS       T01152                                 

Definition
aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
apo  Archaeoglobus profundus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:apo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:apo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
67110..68828
Genome map
AA seq 572 aa AA seqDB search
MRILKINLSEYSYEIEERDDFEEWIGGTALAVKLLKEEIDPKADPLSEDNIIVFAIGPFT
PAYPLASKTVAMFKSPLTGNLGESHAGGRTAMAIANAGYRAIVIKGRSHKPIYVVVDNDK
VYFRDARVIWGIADSLVVGRIIAERERGRGMRTVMRIGGAGVKLVRYACVTTETYRHFGR
LGLGAVFGSKNLRALVVIGRGAFKVKDMKMYKEVYKEIFDLALKSDAMKKYHLIGTPVNV
KPLNEIRALPTRNLTATKFEKADEISGEAFAEYNLGRRIACAHCPIACVHIATLRLPYEN
EPYFYRTIMISYDYELIYSLGSMLGVGSREGVLRLIHKVESLGLDAMSTGVCLAWATEAL
QKGLISENETLVKLEFGNVENYLQAIEYLYQQPNDFYRVLAEGVERASDVYGGKEFALAF
GGNEMPGYHAGYATHIGYLIGLRHSHLDNAGYALDQKSHEYPSPEELVDKLVMEECWRQV
LSSLVVCFFARGVYKPEIVSKAFKPLGYEISEDELEKYGEDTYREKLKIKVEMGFKKPRI
PERIFETECTHGKLERDYIEKALDYWWKKYVS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
ttgaggattttgaagataaacttgagtgaatacagctacgagattgaagagagggacgat
tttgaagaatggataggcgggacagctctagccgttaagcttttgaaagaggaaatagat
cctaaagctgatcctttaagcgaagacaacataatagttttcgctataggcccatttact
ccagcctatcccttagcttcaaagactgttgccatgttcaagagtcctctcaccggcaat
ttaggagagagtcacgctggtggcagaactgctatggcaattgcaaacgctggatacagg
gctatagtgataaaaggaaggagtcacaaaccgatctatgttgttgtggataatgacaag
gtttacttcagggatgcgagggtaatatggggtatagccgattcactcgttgtgggaagg
ataattgcagagagagaaagaggaaggggaatgaggactgtgatgagaataggaggagct
ggagtaaagcttgtcagatatgcatgcgtaacaaccgaaacttacagacacttcggaagg
ttgggattgggagcagttttcggtagcaagaatctgagagccttggttgtaataggaagg
ggagctttcaaggttaaggacatgaaaatgtacaaggaggtttacaaggagatattcgat
ttggctttgaagtctgatgcgatgaagaagtaccaccttataggaactccagtcaacgta
aagcccctgaacgaaataagagctttaccgacgagaaatctgacagcaacaaagtttgaa
aaggctgatgagataagcggtgaagcttttgcagagtacaacttgggaagacgtatagca
tgcgctcactgcccaattgcatgcgttcacatagcaactttaagattgccatacgagaac
gagccctacttctaccgaactataatgatctcctacgactatgaactaatctactccttg
ggttctatgctgggagtggggagtagagagggagtgcttaggctaattcacaaggttgag
agcttaggcttggatgctatgagtacaggagtctgcttagcttgggctacagaagctttg
cagaaaggattaatcagtgaaaatgaaacactcgtaaagcttgagtttggcaacgttgag
aactacttacaggctatagaatacctctatcagcaacctaatgacttctatagagttttg
gctgaaggagttgaaagagcttcagatgtttatggtggaaaagaattcgctttagctttt
ggaggaaacgagatgcccggttaccatgcaggttacgctactcacataggatatctgata
ggattgagacactcccacttggacaatgcaggctatgcattagatcagaaaagtcatgag
tatccatctccagaggaactcgttgataaacttgttatggaggagtgctggagacaggtt
ttgtcgagcttggtcgtatgcttctttgcaaggggagtttacaagccagagatagtcagc
aaggctttcaagcctttaggttacgagataagtgaggacgagcttgaaaagtacggtgaa
gatacttacagggaaaagctaaagataaaggttgaaatgggattcaagaagccaagaatt
cctgagagaatatttgaaacggaatgtactcatgggaagcttgaaagagattacattgag
aaggccttggattactggtggaagaagtacgtatcttaa

DBGET integrated database retrieval system