KEGG   Archaeoglobus profundus: Arcpr_0080Help
Entry
Arcpr_0080        CDS       T01152                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
apo  Archaeoglobus profundus
Pathway
apo00030  Pentose phosphate pathway
apo01100  Metabolic pathways
apo01120  Microbial metabolism in diverse environments
apo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:apo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Arcpr_0080
Enzymes [BR:apo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Arcpr_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C
Motif
Other DBs
NCBI-ProteinID: ADB57156
JGI: Arcpr_0080
UniProt: D2RFT1
Position
67110..68828
Genome map
AA seq 572 aa AA seqDB search
MRILKINLSEYSYEIEERDDFEEWIGGTALAVKLLKEEIDPKADPLSEDNIIVFAIGPFT
PAYPLASKTVAMFKSPLTGNLGESHAGGRTAMAIANAGYRAIVIKGRSHKPIYVVVDNDK
VYFRDARVIWGIADSLVVGRIIAERERGRGMRTVMRIGGAGVKLVRYACVTTETYRHFGR
LGLGAVFGSKNLRALVVIGRGAFKVKDMKMYKEVYKEIFDLALKSDAMKKYHLIGTPVNV
KPLNEIRALPTRNLTATKFEKADEISGEAFAEYNLGRRIACAHCPIACVHIATLRLPYEN
EPYFYRTIMISYDYELIYSLGSMLGVGSREGVLRLIHKVESLGLDAMSTGVCLAWATEAL
QKGLISENETLVKLEFGNVENYLQAIEYLYQQPNDFYRVLAEGVERASDVYGGKEFALAF
GGNEMPGYHAGYATHIGYLIGLRHSHLDNAGYALDQKSHEYPSPEELVDKLVMEECWRQV
LSSLVVCFFARGVYKPEIVSKAFKPLGYEISEDELEKYGEDTYREKLKIKVEMGFKKPRI
PERIFETECTHGKLERDYIEKALDYWWKKYVS
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
ttgaggattttgaagataaacttgagtgaatacagctacgagattgaagagagggacgat
tttgaagaatggataggcgggacagctctagccgttaagcttttgaaagaggaaatagat
cctaaagctgatcctttaagcgaagacaacataatagttttcgctataggcccatttact
ccagcctatcccttagcttcaaagactgttgccatgttcaagagtcctctcaccggcaat
ttaggagagagtcacgctggtggcagaactgctatggcaattgcaaacgctggatacagg
gctatagtgataaaaggaaggagtcacaaaccgatctatgttgttgtggataatgacaag
gtttacttcagggatgcgagggtaatatggggtatagccgattcactcgttgtgggaagg
ataattgcagagagagaaagaggaaggggaatgaggactgtgatgagaataggaggagct
ggagtaaagcttgtcagatatgcatgcgtaacaaccgaaacttacagacacttcggaagg
ttgggattgggagcagttttcggtagcaagaatctgagagccttggttgtaataggaagg
ggagctttcaaggttaaggacatgaaaatgtacaaggaggtttacaaggagatattcgat
ttggctttgaagtctgatgcgatgaagaagtaccaccttataggaactccagtcaacgta
aagcccctgaacgaaataagagctttaccgacgagaaatctgacagcaacaaagtttgaa
aaggctgatgagataagcggtgaagcttttgcagagtacaacttgggaagacgtatagca
tgcgctcactgcccaattgcatgcgttcacatagcaactttaagattgccatacgagaac
gagccctacttctaccgaactataatgatctcctacgactatgaactaatctactccttg
ggttctatgctgggagtggggagtagagagggagtgcttaggctaattcacaaggttgag
agcttaggcttggatgctatgagtacaggagtctgcttagcttgggctacagaagctttg
cagaaaggattaatcagtgaaaatgaaacactcgtaaagcttgagtttggcaacgttgag
aactacttacaggctatagaatacctctatcagcaacctaatgacttctatagagttttg
gctgaaggagttgaaagagcttcagatgtttatggtggaaaagaattcgctttagctttt
ggaggaaacgagatgcccggttaccatgcaggttacgctactcacataggatatctgata
ggattgagacactcccacttggacaatgcaggctatgcattagatcagaaaagtcatgag
tatccatctccagaggaactcgttgataaacttgttatggaggagtgctggagacaggtt
ttgtcgagcttggtcgtatgcttctttgcaaggggagtttacaagccagagatagtcagc
aaggctttcaagcctttaggttacgagataagtgaggacgagcttgaaaagtacggtgaa
gatacttacagggaaaagctaaagataaaggttgaaatgggattcaagaagccaagaatt
cctgagagaatatttgaaacggaatgtactcatgggaagcttgaaagagattacattgag
aaggccttggattactggtggaagaagtacgtatcttaa

DBGET integrated database retrieval system