KEGG   Archaeoglobus profundus: Arcpr_0091Help
Entry
Arcpr_0091        CDS       T01152                                 

Definition
DNA gyrase subunit beta (EC:5.99.1.3)
Orthology
K02470  
DNA gyrase subunit B [EC:5.99.1.3]
Organism
apo  Archaeoglobus profundus
Brite
Enzymes [BR:apo01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.3  DNA topoisomerase (ATP-hydrolysing)
     Arcpr_0091
DNA repair and recombination proteins [BR:apo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      Arcpr_0091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(78856..80754)
Genome map
AA seq 632 aa AA seqDB search
MPISSTFLAMSDYTAEAIEVLDDIQAVRKRPGMYVGSTGSRGFHHLLWEIVDNSIDEALA
GYCNRIVVTLHKDGSASVEDNGRGIPVEEHPIFKKPALEIVMTKLHAGGKFSKKAYKVSG
GLHGVGLSVVNALSEWLEVWVKRNGKIYYQRYERGKPVTPLKVVGETKETGTKIRFKPDP
EIFEVKEFDYDVVAERLRELAFLNKGLRIKLIDERTGKVKEFYSEEGIVGFVKYLNKGKD
VITDVVYISGEKNGINVEIAFQFTNEDFENLLAFANNIHTIEGGTHVSGFRAGLTRAINE
YGKKHVKKFTPISGSDIREGLTAVLSVKVPEPQFEGQTKTKLTNSDVKTVVESLVYNNFL
RWLEEHPSEAQRIIEKCLLAMKAREMARRARELVKRKAEISLTLPGKLADCSSKNVEERE
LFIVEGESAGGSAKQARDRRFQAVLPIRGKIINVEKAGMLRALKNEEIKAIASAIGGGIG
KDFDLSKVRYGKIIIMTDADVDGAHIRTLLLTFFYRYMRPLIEAGMVYIALPPLYRVKKG
DKVYYVYSEKELRDVLKKIGKAEVQRFKGLGEMNPEQLWETAMNPKTRKLVKVTIEDALI
AEKMFRILMGENVDERKEFILNHAKEVKNLDV
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgccgatatcatctacatttttagctatgagcgactacacggctgaggctatcgaggtc
ttagacgacattcaagccgtgagaaagaggccgggaatgtacgtaggaagtaccggaagt
aggggattccatcacctcctatgggagattgtagataacagcatagatgaagctttagct
ggttactgcaatcgaatagtcgttacactgcacaaagacggttctgcgagtgttgaggac
aacgggaggggtattccagttgaggagcatcccattttcaaaaagccagctttagaaatt
gttatgacgaagttgcacgctggaggtaagttcagtaagaaggcctacaaggtctctgga
ggtttgcatggagttggtttgtcagttgtgaatgccctttccgaatggcttgaggtttgg
gtcaagaggaacggaaaaatctactaccagcgttacgagaggggaaaacccgtaacaccc
ttaaaggtagttggagaaacgaaggaaactggaactaaaataagattcaagccggatcct
gagatttttgaagttaaagaattcgattacgatgtcgttgcggaaagacttagggagttg
gcttttctcaataagggtttgagaataaagcttatagatgaaagaactggcaaggttaag
gagttttattcggaggagggtatagtcggattcgtcaaatatctgaacaaaggtaaggac
gtaataacggatgtggtatacataagcggtgagaagaacggtataaacgtcgaaatagct
ttccaattcaccaatgaggatttcgaaaacctactagcttttgcgaacaacatacacaca
atcgaaggaggtactcacgtctctggatttagagcgggcttaacgagagcgataaacgag
tacggaaagaagcacgtaaagaagttcacaccgataagcggttcggatataagggagggc
ttaacggctgttttaagtgttaaggtgcctgagcctcagttcgaggggcaaacgaagaca
aagcttacgaacagtgatgttaagacagttgtagaatctttagtttacaacaacttcctc
agatggcttgaagagcatccaagcgaggctcagaggataatagagaagtgcctgctggca
atgaaagcgagggaaatggcaagaagggcaagagaactagtcaaaagaaaggcagagata
tctctaactctaccgggtaagcttgcggattgttcgtcaaagaatgtggaggagagggaa
ctgttcatagttgagggtgaaagtgccggaggttctgcaaagcaggcaagagataggagg
tttcaagcggttttaccgataagaggtaagatcattaacgtagagaaggctggaatgctg
agagctttaaaaaacgaggagataaaggctatagcctcagccatagggggaggaataggt
aaggatttcgatctctcaaaggttaggtacggaaaaattataataatgaccgatgcggat
gtggacggtgcacatataagaacccttcttttaacattcttctaccgctacatgagacca
cttatagaggctggaatggtttacatagcgttacctccgctttacagggttaagaaaggc
gataaggtttactacgtttattcggaaaaggaactgcgagatgttctcaagaagattgga
aaggccgaggttcagaggttcaaaggtttgggagagatgaatccagagcagttgtgggaa
accgcaatgaatcccaaaacgagaaagctcgtgaaagttacgatagaagatgcactcata
gcagaaaagatgttcagaatcttgatgggagaaaatgttgatgagagaaaggagttcata
ctgaaccatgctaaagaggttaagaacttggacgtttga

DBGET integrated database retrieval system